Target candidate with partial support; inspect missing evidence before prioritizing.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 52.174 Lower values reduce human off-target concern.
- Human E-value
- 5.35e-12
- Gut microbiome similarity
- 0.1% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 0.0 Higher values support similarity to known essential genes.
Structure confidence
- ColabFold pLDDT
- 94.99 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.
Sequence
Chemistry
Sequence
Primary amino-acid sequence viewer.
MDFENELTSKILDPIHGTIRLTTLEIAFINHPLFQRLRNIKQNSFLYKVFPSAVHSRFEHSLGVLHLSSEILNNLRLNAIRYQKKYDDGHVFGHIDQIPKHNIQELRLAALMHDIGHGPVSHQFESFMPGKHEFSDVLPTAYHSIIDVLSKPEQKVEHEQLSLLFSLMIYHDLRKQGKVDDEINIENVLKIIEKRYGDQQIIEEINGKATDILPLMTSIISSCPIDADRMDYLLRDGYFSGVKCGIYDYNRLFMSIVPVEEQGKLYLAYKESGIDSIAEFIGARSSLFSQVYYHKTNRAFATMLSTLCEIMQSKDPQNVIIADVTDRIVDHSDESFIDALKEFYLSCSDDYFLNDKVGEWIDISDTEAVNKKILHDIINRHPWSKVYEAKHSVYKANIVDKENKAWKSQLTGLLTSVLQPHFKPHEFAVDIVSDCAFKDLDKTEVKLLVKDLKNRYEIKPLIECGDKLNQYQIIKYCIRVFVDRDIKERVTPEITYKINDIVVKQIALLN
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Cytoplasmic
No GO or EC annotations are currently loaded for this protein.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 11 | 439 | PANTHER | PTHR11373 | DEOXYNUCLEOSIDE TRIPHOSPHATE TRIPHOSPHOHYDROLASE |
| 53 | 242 | SMART | SM00471 | hd_13 |
| 53 | 242 | InterPro | IPR003607 | HD/PDEase domain |
| 10 | 483 | SUPERFAMILY | SSF109604 | HD-domain/PDEase-like |
| 8 | 381 | Gene3D | G3DSA:1.10.3210.10 | Hypothetical protein af1432 |
| 55 | 253 | CDD | cd00077 | HDc |
| 55 | 253 | InterPro | IPR003607 | HD/PDEase domain |
| 57 | 235 | Pfam | PF01966 | HD domain |
| 57 | 235 | InterPro | IPR006674 | HD domain |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GRT1
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_03062
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural and bioactivity evidence are both available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 0KX RCSB PDB | Q9Y3Z3 | 466.2 Da LogP -1.61 TPSA 253.0 | 2 viol. | ✓ Clean |
C1[C@@H]([C@H](O[C@H]1N2C=CC(=NC2=O)N)COP(=O)(N…
|
|
| 1FZ RCSB PDB | Q9Y3Z3 | 481.2 Da LogP -1.59 TPSA 246.9 | 1 viol. | ✓ Clean |
CC1=CN(C(=O)NC1=O)[C@H]2C[C@@H]([C@H](O2)COP(=O…
|
|
| 3PO RCSB PDB | Q9Y3Z3 | 258.0 Da LogP -0.69 TPSA 170.8 | ✓ Ro5 | ✓ Clean |
OP(=O)(O)OP(=O)(O)OP(=O)(O)O
|
|
| CZF RCSB PDB | Q9Y3Z3 | 524.2 Da LogP -2.62 TPSA 293.0 | 3 viol. | ✓ Clean |
c1nc2c(n1[C@H]3[C@@H]([C@@H]([C@H](O3)COP(=O)(O…
|
|
| DCP RCSB PDB | Q9Y3Z3 | 467.2 Da LogP -1.18 TPSA 250.2 | 2 viol. | ✓ Clean |
C1[C@@H]([C@H](O[C@H]1N2C=CC(=NC2=O)N)CO[P@@](=…
|
|
| DG3 RCSB PDB | Q9Y3Z3 | 491.2 Da LogP -0.28 TPSA 258.6 | 2 viol. | ✓ Clean |
c1nc2c(n1[C@H]3CC[C@H](O3)CO[P@@](=O)(O)O[P@](=…
|
|
| DGT RCSB PDB | I3LG77 | 507.2 Da LogP -1.31 TPSA 278.9 | 3 viol. | ✓ Clean |
c1nc2c(n1[C@H]3C[C@@H]([C@H](O3)CO[P@@](=O)(O)O…
|
|
| DTP RCSB PDB | Q9Y3Z3 | 491.2 Da LogP -0.60 TPSA 258.9 | 2 viol. | ✓ Clean |
c1nc(c2c(n1)n(cn2)[C@H]3C[C@@H]([C@H](O3)CO[P@]…
|
|
| DUT RCSB PDB | Q9Y3Z3 | 468.1 Da LogP -1.47 TPSA 244.1 | 2 viol. | ✓ Clean |
C1[C@@H]([C@H](O[C@H]1N2C=CC(=O)NC2=O)CO[P@@](=…
|
|
| DZ4 RCSB PDB | Q9Y3Z3 | 490.2 Da LogP -1.03 TPSA 261.7 | 2 viol. | ✓ Clean |
c1nc(c2c(n1)n(cn2)[C@H]3C[C@@H]([C@H](O3)CO[P@@…
|
|
| F6G RCSB PDB | Q9Y3Z3 | 470.2 Da LogP -1.90 TPSA 260.0 | 2 viol. | ✓ Clean |
C1[C@@H]([C@H](O[C@H]1N2CN=C(NC2=O)N)COP(=O)(O)…
|
|
| GTF RCSB PDB | Q9Y3Z3 | 503.1 Da LogP -0.94 TPSA 250.2 | 3 viol. | ✓ Clean |
C1=CN(C(=O)N=C1N)[C@H]2C([C@@H]([C@H](O2)COP(=O…
|
|
| HDV RCSB PDB | Q9Y3Z3 | 523.2 Da LogP -0.34 TPSA 258.9 | 3 viol. | ✓ Clean |
Cc1nc(c2c(n1)n(cn2)[C@H]3[C@H]([C@@H]([C@H](O3)…
|
|
| HED RCSB PDB | Q836G9 | 154.3 Da LogP 0.35 TPSA 40.5 | ✓ Ro5 | ✓ Clean |
C(CSSCCO)O
|
|
| HEJ RCSB PDB | Q9Y3Z3 | 507.2 Da LogP -1.63 TPSA 279.1 | 3 viol. | ✓ Clean |
c1nc(c2c(n1)n(cn2)[C@H]3[C@H]([C@@H]([C@H](O3)C…
|
|
| HF4 RCSB PDB | Q9Y3Z3 | 483.2 Da LogP -2.21 TPSA 270.4 | 2 viol. | ✓ Clean |
C1=CN(C(=O)N=C1N)[C@H]2[C@H]([C@@H]([C@H](O2)CO…
|
|
| HF7 RCSB PDB | Q9Y3Z3 | 505.2 Da LogP -0.29 TPSA 258.9 | 3 viol. | ✓ Clean |
Cc1nc(c2c(n1)n(cn2)[C@H]3C[C@@H]([C@H](O3)COP(=…
|
|
| HFD RCSB PDB | Q9Y3Z3 | 525.2 Da LogP -1.49 TPSA 279.1 | 3 viol. | ✓ Clean |
c1nc2c(nc(nc2n1[C@H]3[C@H]([C@@H]([C@H](O3)COP(…
|
|
| MLI RCSB PDB | Q836G9 | 102.0 Da LogP -3.12 TPSA 80.3 | ✓ Ro5 | ✓ Clean |
C(C(=O)[O-])C(=O)[O-]
|
|
| SIN RCSB PDB | Q09374 | 118.1 Da LogP -0.06 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
C(CC(=O)O)C(=O)O
|
|
| T8T RCSB PDB | Q9Y3Z3 | 523.2 Da LogP -0.37 TPSA 258.6 | 3 viol. | ✓ Clean |
c1nc2c(n1[C@H]3C[C@@H]([C@H](O3)CO[P@](=O)(OP(=…
|
|
| TTP RCSB PDB | Q836G9 | 482.2 Da LogP -1.16 TPSA 244.1 | 2 viol. | ✓ Clean |
CC1=CN(C(=O)NC1=O)[C@H]2C[C@@H]([C@H](O2)CO[P@]…
|
|
| XG4 RCSB PDB | Q9Y3Z3 | 506.2 Da LogP -1.73 TPSA 281.7 | 3 viol. | ✓ Clean |
c1nc2c(n1[C@H]3C[C@@H]([C@H](O3)CO[P@@](=O)(N[P…
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC1078621 ZINC | 1.000 | 243.2 Da LogP -2.56 TPSA 130.8 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@H]2O[C@H](CO)[C@@H](O)[C@H]2O)c(=O)n1
|
| ZINC12336757 ZINC | 1.000 | 243.2 Da LogP -2.56 TPSA 130.8 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2O[C@H](CO)[C@H](O)[C@@H]2O)c(=O)n1
|
| ZINC12336758 ZINC | 1.000 | 243.2 Da LogP -2.56 TPSA 130.8 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@H]2O[C@H](CO)[C@H](O)[C@@H]2O)c(=O)n1
|
| ZINC12501922 ZINC | 1.000 | 468.1 Da LogP -1.47 TPSA 244.1 | 2 viol. | ✓ Clean |
O=c1ccn([C@@H]2C[C@H](O)[C@@H](CO[P@@](=O)(O)O[…
|
| ZINC12502055 ZINC | 1.000 | 483.2 Da LogP -2.21 TPSA 270.4 | 2 viol. | ✓ Clean |
Nc1ccn([C@@H]2O[C@@H](CO[P@@](=O)(O)O[P@@](=O)(…
|
| ZINC12502057 ZINC | 1.000 | 483.2 Da LogP -2.21 TPSA 270.4 | 2 viol. | ✓ Clean |
Nc1ccn([C@H]2O[C@@H](CO[P@@](=O)(O)O[P@@](=O)(O…
|
| ZINC12502058 ZINC | 1.000 | 483.2 Da LogP -2.21 TPSA 270.4 | 2 viol. | ✓ Clean |
Nc1ccn([C@@H]2O[C@H](CO[P@@](=O)(O)O[P@@](=O)(O…
|
| ZINC12503365 ZINC | 1.000 | 467.2 Da LogP -1.18 TPSA 250.2 | 2 viol. | ✓ Clean |
Nc1ccn([C@H]2C[C@@H](O)[C@@H](CO[P@](=O)(O)O[P@…
|
| ZINC13431057 ZINC | 1.000 | 483.2 Da LogP -2.21 TPSA 270.4 | 2 viol. | ✓ Clean |
Nc1ccn([C@H]2O[C@@H](CO[P@@](=O)(O)O[P@@](=O)(O…
|
| ZINC13431059 ZINC | 1.000 | 483.2 Da LogP -2.21 TPSA 270.4 | 2 viol. | ✓ Clean |
Nc1ccn([C@@H]2O[C@@H](CO[P@@](=O)(O)O[P@@](=O)(…
|
| ZINC13434879 ZINC | 1.000 | 491.2 Da LogP -0.60 TPSA 258.9 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1C[C@H](O)[C@H](CO[P@@](=O)…
|
| ZINC13434881 ZINC | 1.000 | 491.2 Da LogP -0.60 TPSA 258.9 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1C[C@H](O)[C@H](CO[P@@](=O)(…
|
| ZINC13434883 ZINC | 1.000 | 491.2 Da LogP -0.60 TPSA 258.9 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1C[C@@H](O)[C@H](CO[P@@](=O…
|
| ZINC13434884 ZINC | 1.000 | 491.2 Da LogP -0.60 TPSA 258.9 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1C[C@@H](O)[C@H](CO[P@@](=O)…
|
| ZINC13435050 ZINC | 1.000 | 467.2 Da LogP -1.18 TPSA 250.2 | 2 viol. | ✓ Clean |
Nc1ccn([C@@H]2C[C@H](O)[C@H](CO[P@@](=O)(O)O[P@…
|
| ZINC13436738 ZINC | 1.000 | 468.1 Da LogP -1.47 TPSA 244.1 | 2 viol. | ✓ Clean |
O=c1ccn([C@@H]2C[C@H](O)[C@H](CO[P@@](=O)(O)O[P…
|
| ZINC13436741 ZINC | 1.000 | 468.1 Da LogP -1.47 TPSA 244.1 | 2 viol. | ✓ Clean |
O=c1ccn([C@H]2C[C@H](O)[C@H](CO[P@@](=O)(O)O[P@…
|
| ZINC13436743 ZINC | 1.000 | 468.1 Da LogP -1.47 TPSA 244.1 | 2 viol. | ✓ Clean |
O=c1ccn([C@@H]2C[C@@H](O)[C@H](CO[P@@](=O)(O)O[…
|
| ZINC13436745 ZINC | 1.000 | 468.1 Da LogP -1.47 TPSA 244.1 | 2 viol. | ✓ Clean |
O=c1ccn([C@H]2C[C@@H](O)[C@H](CO[P@@](=O)(O)O[P…
|
| ZINC13507072 ZINC | 1.000 | 482.2 Da LogP -1.16 TPSA 244.1 | 2 viol. | ✓ Clean |
Cc1cn([C@@H]2C[C@@H](O)[C@H](CO[P@@](=O)(O)O[P@…
|
| ZINC16969357 ZINC | 1.000 | 243.2 Da LogP -2.56 TPSA 130.8 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@H]2O[C@@H](CO)[C@H](O)[C@H]2O)c(=O)n1
|
| ZINC25726736 ZINC | 1.000 | 483.2 Da LogP -2.21 TPSA 270.4 | 2 viol. | ✓ Clean |
Nc1ccn([C@H]2O[C@@H](CO[P@@](=O)(O)O[P@@](=O)(O…
|
| ZINC2583632 ZINC | 1.000 | 243.2 Da LogP -2.56 TPSA 130.8 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2O[C@H](CO)[C@@H](O)[C@H]2O)c(=O)n1
|
| ZINC33979251 ZINC | 1.000 | 482.2 Da LogP -1.16 TPSA 244.1 | 2 viol. | ✓ Clean |
Cc1cn([C@@H]2C[C@H](O)[C@H](CO[P@@](=O)(O)O[P@@…
|
| ZINC3795098 ZINC | 1.000 | 243.2 Da LogP -2.56 TPSA 130.8 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2O[C@H](CO)[C@@H](O)[C@@H]2O)c(=O)…
|
| ZINC3830623 ZINC | 1.000 | 243.2 Da LogP -2.56 TPSA 130.8 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@H]2O[C@@H](CO)[C@@H](O)[C@H]2O)c(=O)n1
|
| ZINC3830624 ZINC | 1.000 | 243.2 Da LogP -2.56 TPSA 130.8 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2O[C@@H](CO)[C@@H](O)[C@H]2O)c(=O)…
|
| ZINC3861746 ZINC | 1.000 | 483.2 Da LogP -2.21 TPSA 270.4 | 2 viol. | ✓ Clean |
Nc1ccn([C@@H]2O[C@H](CO[P@](=O)(O)O[P@@](=O)(O)…
|
| ZINC3978018 ZINC | 1.000 | 243.2 Da LogP -2.56 TPSA 130.8 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@H]2O[C@H](CO)[C@@H](O)[C@@H]2O)c(=O)n1
|
| ZINC53683723 ZINC | 1.000 | 483.2 Da LogP -2.21 TPSA 270.4 | 2 viol. | ✓ Clean |
Nc1ccn([C@@H]2O[C@@H](CO[P@@](=O)(O)O[P@@](=O)(…
|
| ZINC6091575 ZINC | 1.000 | 243.2 Da LogP -2.56 TPSA 130.8 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2O[C@H](CO)[C@H](O)[C@H]2O)c(=O)n1
|
| ZINC6234828 ZINC | 1.000 | 243.2 Da LogP -2.56 TPSA 130.8 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@H]2O[C@H](CO)[C@H](O)[C@H]2O)c(=O)n1
|
| ZINC6524892 ZINC | 1.000 | 243.2 Da LogP -2.56 TPSA 130.8 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2O[C@@H](CO)[C@H](O)[C@H]2O)c(=O)n1
|
| ZINC6827739 ZINC | 1.000 | 258.0 Da LogP -0.69 TPSA 170.8 | ✓ Ro5 | ✓ Clean |
O=P(O)(O)OP(=O)(O)OP(=O)(O)O
|
| ZINC82142138 ZINC | 1.000 | 483.2 Da LogP -2.21 TPSA 270.4 | 2 viol. | ✓ Clean |
Nc1ccn([C@@H]2O[C@H](CO[P@@](=O)(O)O[P@@](=O)(O…
|
| ZINC82142140 ZINC | 1.000 | 483.2 Da LogP -2.21 TPSA 270.4 | 2 viol. | ✓ Clean |
Nc1ccn([C@@H]2O[C@H](CO[P@@](=O)(O)O[P@@](=O)(O…
|
| ZINC8215662 ZINC | 1.000 | 491.2 Da LogP -0.60 TPSA 258.9 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1C[C@H](O)[C@@H](CO[P@@](=O)…
|
| ZINC8215945 ZINC | 1.000 | 467.2 Da LogP -1.18 TPSA 250.2 | 2 viol. | ✓ Clean |
Nc1ccn([C@H]2C[C@H](O)[C@@H](CO[P@@](=O)(O)O[P@…
|
| ZINC8664605 ZINC | 1.000 | 491.2 Da LogP -0.60 TPSA 258.9 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1C[C@H](O)[C@@H](CO[P@@](=O…
|
| ZINC895248 ZINC | 1.000 | 243.2 Da LogP -2.56 TPSA 130.8 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@H]2O[C@@H](CO)[C@H](O)[C@@H]2O)c(=O)n1
|
| ZINC12503703 ZINC | 0.982 | 427.2 Da LogP -1.42 TPSA 232.3 | 2 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@@H]2C[C@H](O)[C@@H](CO[P@@](=O)(…
|
| ZINC8215878 ZINC | 0.982 | 427.2 Da LogP -1.42 TPSA 232.3 | 2 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@H]2C[C@H](O)[C@@H](CO[P@@](=O)(O…
|
| ZINC33902769 ZINC | 0.981 | 445.2 Da LogP -1.61 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1nc(F)nc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)OP…
|
| ZINC12495199 ZINC | 0.981 | 411.2 Da LogP -0.72 TPSA 212.4 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1C[C@H](O)[C@@H](CO[P@@](=O…
|
| ZINC13434873 ZINC | 0.981 | 411.2 Da LogP -0.72 TPSA 212.4 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1C[C@H](O)[C@H](CO[P@@](=O)…
|
| ZINC13434875 ZINC | 0.981 | 411.2 Da LogP -0.72 TPSA 212.4 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1C[C@H](O)[C@H](CO[P@@](=O)(…
|
| ZINC13434876 ZINC | 0.981 | 411.2 Da LogP -0.72 TPSA 212.4 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1C[C@@H](O)[C@H](CO[P@](=O)…
|
| ZINC13434878 ZINC | 0.981 | 411.2 Da LogP -0.72 TPSA 212.4 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1C[C@@H](O)[C@H](CO[P@@](=O)…
|
| ZINC8215728 ZINC | 0.981 | 411.2 Da LogP -0.72 TPSA 212.4 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1C[C@H](O)[C@@H](CO[P@@](=O)…
|
| ZINC12360703 ZINC | 0.980 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)OP(=O…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.