Protein target profile

KP13_05461

Periplasmic murein peptide-binding protein

Genome: KpKP13 Gene: AHE44949.1 mppA 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GS79

Export view

Length 538

Pocket druggability 0.891

Direct ligand evidence 0 71 total records

Functional annotation 0 EC 5 GO

Target summary

Strong target candidate with converging metabolic, structural and chemical evidence.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Main supporting evidence

Independent pocket support: FPocket + P2Rank Both predictors report a high-scoring binding site (FPocket 0.89, P2Rank 0.97). Use the 3D pocket comparison to verify whether they identify the same site. No similar human protein detected The current BLAST sequence screen did not find a significant human match, lowering apparent off-target risk. Core gene across strains Marked as conserved by both pan-genome tools: Roary and CoreCruncher. Strong predicted binding pocket FPocket selected-pocket score 0.89. This is a computational pocket signal, not binding validation. Review the complete evidence below

Risks to review

Evidence gaps

No metabolic context No SBML/network-derived reaction evidence is loaded for this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target: No hit
Gut microbiome similarity: 2.4% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG): Y
DEG identity (%): 86.617 Higher values support similarity to known essential genes.
DEG E-value: 0.0 Smaller values mean stronger essential-gene similarity.

Localization

Localization: Periplasmic

Structure confidence

ColabFold pLDDT: 94.12 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.891

Structure A0A0H3GS79

Pocket Pocket 1

P2Rank 0.973

Structure A0A0H3GS79

Pocket Pocket 1

ColabFold model

FPocket 0.994 · Pocket 1

P2Rank 0.979 · Pocket 1

Core conservation Conserved core gene

Roary core

CoreCruncher core

Gut microbiome 112 / 4744 genomes with a hit

Prevalence 2.4%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

UniProt A0A0H3GS79

Sequence

Primary amino-acid sequence viewer.

MKYPVALTCGALWLASVSSLAWAADVPPGTVLAEKQLLVRHIKDEPASLDPAKAVGLPEIQVIRDLFEGLVNQDAKGNLVPGVATRWQSNDNRVWTFTLRDNARWSDGTPVTAEDFVYSWQRLVDPKTTSPFAWFAALAGIANAQNIIDGKAAPETLGVTAVDAHTLRVQLDKPLPWFSNLTASFAFYPVQKANVDSGANWTRPGSLVGNGAYVLKDRVVNEKLVVVPNTHYWDNAKTVIQQVTFVPINQESAATKRYLAGDIDITESFPKNMYQKLLKDIPGQVYTPPQLGTYYYAFNTQKGPTADERVRLALSMTIDRRVMAEKVLGTGEKPAWRFTPDVTAGFTPQPSQFESMSQAELNAQAKALLAAAGYGPNRPLKLTLLYNTSENHQKIAIAVASMWKKNLGVEVKLQNQEWKTYIDSRNTGNFDVIRASWVGDYNEPSTFLSLLTSTHSGNISRFNDPAYDKILAQAAVENSAKARNDDYNAAEKIIMVKAPIAPIYQYTNGRLIKPWLKGYPITNPEDVAYSRTMYIVKH

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

5 GO

Gene Ontology (GO)

GO:0043190 A complex for the transport of metabolites into and out of the cell, typically comprised of four domains; two membrane-associated domains and two ATP-binding domains at the intracellular face of the membrane, that form a central pore through the plasma membrane. Each of the four core domains may be encoded as a separate polypeptide or the domains can be fused in any one of a number of ways into multidomain polypeptides. In Bacteria and Archaebacteria, ABC transporters also include substrate binding proteins to bind substrate external to the cytoplasm and deliver it to the transporter.
GO:0055085 The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other.
GO:0030288 The region between the inner (cytoplasmic or plasma) membrane and outer membrane of organisms with two membranes such as Gram negative bacteria. These periplasmic spaces are relatively thick and contain a thin peptidoglycan layer (PGL), also referred to as a thin cell wall.
GO:1904680 Enables the transfer of a peptide from one side of a membrane to the other.
GO:0015833 The directed movement of peptides, compounds of two or more amino acids where the alpha carboxyl group of one is bound to the alpha amino group of another, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

20 records

Show feature table

Start	End	DB	Term	Name
36	535	CDD	cd08504	PBP2_OppA
1	23	SignalP_EUK	SignalP-noTM	SignalP-noTM
33	529	SUPERFAMILY	SSF53850	Periplasmic binding protein-like II
68	191	FunFam	G3DSA:3.90.76.10:FF:000001	Oligopeptide ABC transporter substrate-binding protein
1	23	Phobius	SIGNAL_PEPTIDE	Signal peptide region
5	15	Phobius	SIGNAL_PEPTIDE_H_REGION	Hydrophobic region of a signal peptide.
1	23	SignalP_GRAM_POSITIVE	SignalP-TM	SignalP-TM
3	538	PIRSF	PIRSF002741	MppA
3	538	InterPro	IPR030678	Peptide/nickel binding protein, MppA-type
79	454	Pfam	PF00496	Bacterial extracellular solute-binding proteins, family 5 Middle
79	454	InterPro	IPR000914	Solute-binding protein family 5 domain
13	530	PANTHER	PTHR30290	PERIPLASMIC BINDING COMPONENT OF ABC TRANSPORTER
13	530	InterPro	IPR039424	Solute-binding protein family 5
292	508	FunFam	G3DSA:3.10.105.10:FF:000001	Oligopeptide ABC transporter, oligopeptide-binding protein
292	507	Gene3D	G3DSA:3.10.105.10	-
16	23	Phobius	SIGNAL_PEPTIDE_C_REGION	C-terminal region of a signal peptide.
68	191	Gene3D	G3DSA:3.90.76.10	-
42	519	Gene3D	G3DSA:3.40.190.10	-
1	4	Phobius	SIGNAL_PEPTIDE_N_REGION	N-terminal region of a signal peptide.
24	538	Phobius	NON_CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low

How colors and pocket overlays are used

Uniform protein color marks the displayed model as a single molecular object.

Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.

Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.

'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.

'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.

'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.

Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Site 1 FPocket #1

0.891

Likely same site as P2Rank 1 3.1 Å 31 shared residues 100% of smaller site

Unusual size

Show in viewer

Surrounding area

Site 2 FPocket #3

0.438

Show in viewer

Surrounding area

Binding pockets · P2Rank

Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Site 1 P2Rank #1

0.973

Likely same site as FPocket 1 3.1 Å 31 shared residues 100% of smaller site

Show in viewer

Surrounding area

Site 2 P2Rank #2

0.592

Show in viewer

Surrounding area

Site 3 P2Rank #3

0.062

Show in viewer

Surrounding area

Site 4 P2Rank #4

0.05

Show in viewer

Surrounding area

Site 5 P2Rank #5

0.03

Show in viewer

Surrounding area

Binding pockets · P2Rank

Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Site 1 P2Rank #1

0.979

Likely same site as FPocket 1 1.0 Å 39 shared residues 93% of smaller site

Show in viewer

Surrounding area

Site 2 P2Rank #2

0.557

Show in viewer

Surrounding area

Site 3 P2Rank #3

0.048

Show in viewer

Surrounding area

Site 4 P2Rank #4

0.043

Show in viewer

Surrounding area

Site 5 P2Rank #5

0.018

Show in viewer

Surrounding area

All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold DB AF_A0A0H3GS79	AlphaFold DB	—	—	full sequence	—	Viewing
ColabFold KP13_05461	ColabFold	—	—	full sequence	—	Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

71 records

Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records

Transferred evidence 21 records from similar proteins

Structural ligands 21 0 loaded crystals

Measured bioactivity 0 direct and transferred ChEMBL records

Proposed compounds 50 similarity-based ZINC candidates

Best available ligand signal

6RP PDB via homolog 192.2 Da · LogP 0.21 · TPSA 72.9 Open detail RCSB PDB

9YH PDB via homolog Detail RCSB PDB

9YK PDB via homolog Detail RCSB PDB

BHN PDB via homolog Detail RCSB PDB

BHR PDB via homolog Detail RCSB PDB

Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.

No PDB structure with a co-crystallized ligand found for this exact protein.

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Ligand	Source crystal	UniProt (homolog)	MW · LogP · TPSA	Lipinski	PAINS	SMILES
6RP RCSB PDB	5L8D	P33590	192.2 Da LogP 0.21 TPSA 72.9	✓ Ro5	✓ Clean	`c1cnn(c1)C(C(=O)O)n2cccn2`
9YH RCSB PDB	5ON0	P33590	448.5 Da LogP 2.60 TPSA 110.5	✓ Ro5	Alert	`COc1cccc(c1O)CN(CCN(Cc2ccccc2SC)CC(=O)O)CC(=O)O`
9YK RCSB PDB	5ON1	P33590	434.5 Da LogP 2.29 TPSA 121.5	✓ Ro5	Alert	`CSc1ccccc1CN(CCN(Cc2cccc(c2O)O)CC(=O)O)CC(=O)O`
BHN RCSB PDB	3MVZ	P33590	388.4 Da LogP 1.57 TPSA 121.5	✓ Ro5	Alert	`c1ccc(c(c1)C[N@@](CC[N@](Cc2ccccc2O)CC(=O)O)CC(…`
BHR RCSB PDB	3MW0	P33590	404.4 Da LogP 1.28 TPSA 141.8	✓ Ro5	Alert	`c1ccc(c(c1)C[N@@](CC[N@](Cc2cccc(c2O)O)CC(=O)O)…`
BHZ RCSB PDB	3MVW	P33590	372.4 Da LogP 1.87 TPSA 101.3	✓ Ro5	Alert	`c1ccc(cc1)C[N@@](CC[N@](Cc2ccccc2O)CC(=O)O)CC(=…`
CMO RCSB PDB	5L8D	P33590	28.0 Da LogP -0.04 TPSA 19.9	✓ Ro5	✓ Clean	`[C-]#[O+]`
DTD RCSB PDB	3MW0	P33590	152.2 Da LogP 0.10 TPSA 40.5	✓ Ro5	✓ Clean	`C1[C@@H]([C@H](CSS1)O)O`
DTT RCSB PDB	1ZLQ	P33590	154.3 Da LogP -0.43 TPSA 40.5	✓ Ro5	✓ Clean	`C([C@@H]([C@H](CS)O)O)S`
DTU RCSB PDB	3MVX	P33590	154.3 Da LogP -0.43 TPSA 40.5	✓ Ro5	✓ Clean	`C([C@H]([C@H](CS)O)O)S`
DTV RCSB PDB	3MVX	P33590	154.3 Da LogP -0.43 TPSA 40.5	✓ Ro5	✓ Clean	`C([C@H]([C@@H](CS)O)O)S`
EDT RCSB PDB	1ZLQ	P33590	292.2 Da LogP -2.07 TPSA 155.7	✓ Ro5	✓ Clean	`C(CN(CC(=O)O)CC(=O)O)N(CC(=O)O)CC(=O)O`
GDS RCSB PDB	3M8U	B8F653	612.6 Da LogP -3.88 TPSA 317.6	3 viol.	✓ Clean	`C(CC(=O)N[C@@H](CSSC[C@@H](C(=O)NCC(=O)O)NC(=O)…`
HCT RCSB PDB	3DP8	P33590	190.2 Da LogP 0.03 TPSA 111.9	✓ Ro5	✓ Clean	`C(CC(=O)O)[C@H](CC(=O)O)C(=O)O`
IUM RCSB PDB	1B40	P06202	270.0 Da LogP -2.38 TPSA 46.1	✓ Ro5	✓ Clean	`[O-][U+4][O-]`
MHI RCSB PDB	3O9P	P77348	390.4 Da LogP -2.17 TPSA 222.1	1 viol.	✓ Clean	`C[C@@H](C(=O)N[C@H](CCC(=O)N[C@@H](CCC[C@H](C(=…`
MLI RCSB PDB	3M8U	B8F653	102.0 Da LogP -3.12 TPSA 80.3	✓ Ro5	✓ Clean	`C(C(=O)[O-])C(=O)[O-]`
NGE RCSB PDB	5YYB	Q7VL18	325.3 Da LogP -4.90 TPSA 197.0	1 viol.	✓ Clean	`C1[C@@H]([C@H]([C@@H](O[C@@]1(C(=O)O)O)[C@@H]([…`
PER RCSB PDB	3MVZ	P33590	32.0 Da LogP -2.38 TPSA 46.1	✓ Ro5	✓ Clean	`[O-][O-]`
SLB RCSB PDB	5Z99	Q7VL18	309.3 Da LogP -3.87 TPSA 176.8	1 viol.	✓ Clean	`CC(=O)N[C@@H]1[C@H](C[C@](O[C@H]1[C@@H]([C@@H](…`
U1 RCSB PDB	1B05	P06202	238.0 Da LogP 0.00 TPSA 0.0	✓ Ro5	✓ Clean	`[U]`

Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).

No ChEMBL bioactivity data found for this exact protein.

Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).

No ChEMBL hits found through similar proteins.

Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).

Ligand	Tanimoto	MW · LogP · TPSA	Lipinski	PAINS	SMILES
ZINC106403632 ZINC	1.000	325.3 Da LogP -4.90 TPSA 197.0	1 viol.	✓ Clean	`O=C(CO)N[C@H]1[C@@H]([C@H](O)[C@H](O)CO)O[C@@](…`
ZINC12359995 ZINC	1.000	309.3 Da LogP -3.87 TPSA 176.8	1 viol.	✓ Clean	`CC(=O)N[C@@H]1[C@H](O)C[C@](O)(C(=O)O)O[C@H]1[C…`
ZINC15206143 ZINC	1.000	309.3 Da LogP -3.87 TPSA 176.8	1 viol.	✓ Clean	`CC(=O)N[C@H]1[C@@H]([C@@H](O)[C@@H](O)CO)O[C@@]…`
ZINC15206146 ZINC	1.000	309.3 Da LogP -3.87 TPSA 176.8	1 viol.	✓ Clean	`CC(=O)N[C@H]1[C@@H]([C@H](O)[C@@H](O)CO)O[C@@](…`
ZINC15206149 ZINC	1.000	309.3 Da LogP -3.87 TPSA 176.8	1 viol.	✓ Clean	`CC(=O)N[C@@H]1[C@H](O)C[C@](O)(C(=O)O)O[C@H]1[C…`
ZINC1532591 ZINC	1.000	309.3 Da LogP -3.87 TPSA 176.8	1 viol.	✓ Clean	`CC(=O)N[C@@H]1[C@@H]([C@H](O)[C@H](O)CO)O[C@@](…`
ZINC19364242 ZINC	1.000	292.2 Da LogP -2.07 TPSA 155.7	✓ Ro5	✓ Clean	`O=C(O)CN(CCN(CC(=O)O)CC(=O)O)CC(=O)O`
ZINC19368612 ZINC	1.000	388.4 Da LogP 1.57 TPSA 121.5	✓ Ro5	Alert	`O=C(O)CN(CCN(CC(=O)O)Cc1ccccc1O)Cc1ccccc1O`
ZINC247362640 ZINC	1.000	325.3 Da LogP -4.90 TPSA 197.0	1 viol.	✓ Clean	`O=C(CO)N[C@H]1[C@@H]([C@H](O)[C@@H](O)CO)O[C@@]…`
ZINC247362642 ZINC	1.000	325.3 Da LogP -4.90 TPSA 197.0	1 viol.	✓ Clean	`O=C(CO)N[C@H]1[C@@H]([C@@H](O)[C@@H](O)CO)O[C@@…`
ZINC247362655 ZINC	1.000	325.3 Da LogP -4.90 TPSA 197.0	1 viol.	✓ Clean	`O=C(CO)N[C@H]1[C@@H]([C@@H](O)[C@H](O)CO)O[C@@]…`
ZINC2586055 ZINC	1.000	309.3 Da LogP -3.87 TPSA 176.8	1 viol.	✓ Clean	`CC(=O)N[C@H]1[C@@H](O)C[C@](O)(C(=O)O)O[C@@H]1[…`
ZINC3793840 ZINC	1.000	309.3 Da LogP -3.87 TPSA 176.8	1 viol.	✓ Clean	`CC(=O)N[C@@H]1[C@@H](O)C[C@@](O)(C(=O)O)O[C@H]1…`
ZINC3870085 ZINC	1.000	309.3 Da LogP -3.87 TPSA 176.8	1 viol.	✓ Clean	`CC(=O)N[C@H]1[C@@H]([C@H](O)[C@H](O)CO)O[C@@](O…`
ZINC3870086 ZINC	1.000	309.3 Da LogP -3.87 TPSA 176.8	1 viol.	✓ Clean	`CC(=O)N[C@@H]1[C@@H](O)C[C@](O)(C(=O)O)O[C@@H]1…`
ZINC4081651 ZINC	1.000	309.3 Da LogP -3.87 TPSA 176.8	1 viol.	✓ Clean	`CC(=O)N[C@@H]1[C@@H](O)C[C@](O)(C(=O)O)O[C@H]1[…`
ZINC4096097 ZINC	1.000	325.3 Da LogP -4.90 TPSA 197.0	1 viol.	✓ Clean	`O=C(CO)N[C@@H]1[C@@H](O)C[C@@](O)(C(=O)O)O[C@H]…`
ZINC4293691 ZINC	1.000	309.3 Da LogP -3.87 TPSA 176.8	1 viol.	✓ Clean	`CC(=O)N[C@@H]1[C@@H](O)C[C@@](O)(C(=O)O)O[C@@H]…`
ZINC43509538 ZINC	1.000	309.3 Da LogP -3.87 TPSA 176.8	1 viol.	✓ Clean	`CC(=O)N[C@H]1[C@@H](O)C[C@@](O)(C(=O)O)O[C@H]1[…`
ZINC44790306 ZINC	1.000	309.3 Da LogP -3.87 TPSA 176.8	1 viol.	✓ Clean	`CC(=O)N[C@@H]1[C@@H](O)C[C@](O)(C(=O)O)O[C@@H]1…`
ZINC5227885 ZINC	1.000	309.3 Da LogP -3.87 TPSA 176.8	1 viol.	✓ Clean	`CC(=O)N[C@@H]1[C@H](O)C[C@](O)(C(=O)O)O[C@H]1[C…`
ZINC71789682 ZINC	1.000	309.3 Da LogP -3.87 TPSA 176.8	1 viol.	✓ Clean	`CC(=O)N[C@@H]1[C@@H](O)C[C@](O)(C(=O)O)O[C@@H]1…`
ZINC71789683 ZINC	1.000	309.3 Da LogP -3.87 TPSA 176.8	1 viol.	✓ Clean	`CC(=O)N[C@@H]1[C@@H](O)C[C@](O)(C(=O)O)O[C@@H]1…`
ZINC71789800 ZINC	1.000	309.3 Da LogP -3.87 TPSA 176.8	1 viol.	✓ Clean	`CC(=O)N[C@H]1[C@@H]([C@@H](O)[C@H](O)CO)O[C@@](…`
ZINC71789801 ZINC	1.000	309.3 Da LogP -3.87 TPSA 176.8	1 viol.	✓ Clean	`CC(=O)N[C@@H]1[C@H](O)C[C@](O)(C(=O)O)O[C@H]1[C…`
ZINC19419017 ZINC	0.933	393.3 Da LogP -2.68 TPSA 196.2	✓ Ro5	✓ Clean	`O=C(O)CN(CCN(CC(=O)O)CC(=O)O)CCN(CC(=O)O)CC(=O)O`
ZINC22593216 ZINC	0.933	494.5 Da LogP -3.30 TPSA 236.8	1 viol.	✓ Clean	`O=C(O)CN(CCN(CCN(CC(=O)O)CC(=O)O)CC(=O)O)CCN(CC…`
ZINC4556980 ZINC	0.825	321.4 Da LogP -1.77 TPSA 158.8	✓ Ro5	✓ Clean	`CSC[C@H](NC(=O)CC[C@@H](N)C(=O)O)C(=O)NCC(=O)O`
ZINC33977700 ZINC	0.818	308.3 Da LogP -3.91 TPSA 182.6	1 viol.	✓ Clean	`CC(=O)N[C@@H]1[C@@H](O)C[C@@](O)(C(=O)O)O[C@H]1…`
ZINC100655903 ZINC	0.783	323.3 Da LogP -3.78 TPSA 165.8	1 viol.	✓ Clean	`COC(=O)[C@]1(O)C[C@H](O)[C@H](NC(C)=O)[C@H]([C@…`
ZINC100655904 ZINC	0.783	323.3 Da LogP -3.78 TPSA 165.8	1 viol.	✓ Clean	`COC(=O)[C@]1(O)C[C@H](O)[C@H](NC(C)=O)[C@H]([C@…`
ZINC100655906 ZINC	0.783	323.3 Da LogP -3.78 TPSA 165.8	1 viol.	✓ Clean	`COC(=O)[C@]1(O)C[C@H](O)[C@H](NC(C)=O)[C@H]([C@…`
ZINC146216515 ZINC	0.783	323.3 Da LogP -3.78 TPSA 165.8	1 viol.	✓ Clean	`COC(=O)[C@@]1(O)C[C@@H](O)[C@@H](NC(C)=O)[C@H](…`
ZINC2382416875 ZINC	0.783	323.3 Da LogP -3.78 TPSA 165.8	1 viol.	✓ Clean	`COC(=O)[C@@]1(O)C[C@H](O)[C@@H](NC(C)=O)[C@H]([…`
ZINC2558706 ZINC	0.783	323.3 Da LogP -3.78 TPSA 165.8	1 viol.	✓ Clean	`COC(=O)[C@@]1(O)C[C@@H](O)[C@H](NC(C)=O)[C@@H](…`
ZINC2586056 ZINC	0.783	323.3 Da LogP -3.78 TPSA 165.8	1 viol.	✓ Clean	`COC(=O)[C@@]1(O)C[C@H](O)[C@H](NC(C)=O)[C@@H]([…`
ZINC26254851 ZINC	0.783	323.3 Da LogP -3.78 TPSA 165.8	1 viol.	✓ Clean	`COC(=O)[C@@]1(O)C[C@H](O)[C@@H](NC(C)=O)[C@H]([…`
ZINC4293695 ZINC	0.783	323.3 Da LogP -3.78 TPSA 165.8	1 viol.	✓ Clean	`COC(=O)[C@]1(O)C[C@@H](O)[C@@H](NC(C)=O)[C@@H](…`
ZINC4293696 ZINC	0.783	323.3 Da LogP -3.78 TPSA 165.8	1 viol.	✓ Clean	`COC(=O)[C@]1(O)C[C@H](O)[C@@H](NC(C)=O)[C@@H]([…`
ZINC4293697 ZINC	0.783	323.3 Da LogP -3.78 TPSA 165.8	1 viol.	✓ Clean	`COC(=O)[C@]1(O)C[C@@H](O)[C@@H](NC(C)=O)[C@H]([…`
ZINC4293698 ZINC	0.783	323.3 Da LogP -3.78 TPSA 165.8	1 viol.	✓ Clean	`COC(=O)[C@]1(O)C[C@H](O)[C@@H](NC(C)=O)[C@H]([C…`
ZINC43771922 ZINC	0.783	323.3 Da LogP -3.78 TPSA 165.8	1 viol.	✓ Clean	`COC(=O)[C@]1(O)C[C@H](O)[C@@H](NC(C)=O)[C@H]([C…`
ZINC4533821 ZINC	0.783	323.3 Da LogP -3.78 TPSA 165.8	1 viol.	✓ Clean	`COC(=O)[C@@]1(O)C[C@@H](O)[C@@H](NC(C)=O)[C@@H]…`
ZINC4533822 ZINC	0.783	323.3 Da LogP -3.78 TPSA 165.8	1 viol.	✓ Clean	`COC(=O)[C@@]1(O)C[C@H](O)[C@@H](NC(C)=O)[C@@H](…`
ZINC64220345 ZINC	0.783	323.3 Da LogP -3.78 TPSA 165.8	1 viol.	✓ Clean	`COC(=O)[C@]1(O)C[C@H](O)[C@H](NC(C)=O)[C@H]([C@…`
ZINC76938880 ZINC	0.783	323.3 Da LogP -3.78 TPSA 165.8	1 viol.	✓ Clean	`COC(=O)[C@]1(O)C[C@@H](O)[C@@H](NC(C)=O)[C@H]([…`
ZINC95635434 ZINC	0.783	323.3 Da LogP -3.78 TPSA 165.8	1 viol.	✓ Clean	`COC(=O)[C@@]1(O)C[C@@H](O)[C@@H](NC(C)=O)[C@H](…`
ZINC1769289 ZINC	0.765	306.3 Da LogP -1.68 TPSA 155.7	✓ Ro5	✓ Clean	`O=C(O)CN(CCCN(CC(=O)O)CC(=O)O)CC(=O)O`
ZINC4683946 ZINC	0.765	320.3 Da LogP -1.29 TPSA 155.7	✓ Ro5	✓ Clean	`O=C(O)CN(CCCCN(CC(=O)O)CC(=O)O)CC(=O)O`
ZINC22451417 ZINC	0.750	416.5 Da LogP 2.05 TPSA 110.5	✓ Ro5	Alert	`CCOC(=O)CN(CCN(CC(=O)O)Cc1ccccc1O)Cc1ccccc1O`

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.