Strong target candidate with converging metabolic, structural and chemical evidence.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 0.6% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 0.0 Higher values support similarity to known essential genes.
Localization
- Localization
- CytoplasmicMembrane
Structure confidence
- ColabFold pLDDT
- 92.49 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelThe selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.
Sequence
Sequence
Primary amino-acid sequence viewer.
MSTVTISDTPFVGNDRLLVGIVLSVLTFWLFAQSVINVVPAMKSSLDISLETLTLAVSLSALFSGCFVVASGGLADKFGRMRMTTLGLGLSIVGSAMLVVAQGPGLFLAGRVLQGLSAACIMPATLALIKTWYEGRARQRAVSFWVIGSWGGSGLCSFVGGAIATGLGWRWIFVFSIAVALLALFLLRGTPESRSASASQHKLDVGGLLSLIVALVLVNLFISKGHGWGWSSPLSLTMLAGALAAGTIFIRNGMRKGEAALIDFALFRNRAYGAAVLSNFLLNGAIGTMMIASIWLQQGHHLTPLESGMMTLGYLVTVLAMIRVGEKLLQRYGARLPMMAGPVLTAIAIALISCTFLEKALYIGVVFASNVLFGLGLGCYATPSTDTAVANAPENKIGVASGIYKMGSSLGGAMGIAVTASLFALFLPLGMAHAAQYALWFNAVLCLGAMAVSALLLPRASHS
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
2- GO:0022857 Enables the transfer of a substance, usually a specific substance or a group of related substances, from one side of a membrane to the other.
- GO:0055085 The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 382 | 409 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 332 | 354 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 458 | 463 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 251 | 270 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 223 | 227 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 17 | 461 | ProSiteProfiles | PS50850 | Major facilitator superfamily (MFS) profile. |
| 17 | 461 | InterPro | IPR020846 | Major facilitator superfamily domain |
| 281 | 460 | Pfam | PF07690 | Major Facilitator Superfamily |
| 281 | 460 | InterPro | IPR011701 | Major facilitator superfamily |
| 23 | 234 | Pfam | PF07690 | Major Facilitator Superfamily |
| 23 | 234 | InterPro | IPR011701 | Major facilitator superfamily |
| 271 | 295 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 271 | 293 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 164 | 168 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 336 | 354 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 169 | 187 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 86 | 108 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 203 | 222 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 228 | 250 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 167 | 186 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 112 | 129 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 107 | 111 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 360 | 381 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 112 | 129 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 141 | 163 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 308 | 325 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 15 | 460 | SUPERFAMILY | SSF103473 | MFS general substrate transporter |
| 15 | 460 | InterPro | IPR036259 | MFS transporter superfamily |
| 436 | 458 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 17 | 36 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 17 | 457 | PANTHER | PTHR42718 | MAJOR FACILITATOR SUPERFAMILY MULTIDRUG TRANSPORTER MFSC |
| 228 | 250 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 432 | 436 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 307 | 324 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 37 | 55 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 325 | 335 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 130 | 140 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 20 | 42 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 141 | 163 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 410 | 432 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 52 | 74 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 86 | 106 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 188 | 202 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 206 | 223 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 17 | 210 | Gene3D | G3DSA:1.20.1720.10 | Multidrug resistance protein D |
| 360 | 382 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 1 | 16 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 264 | 463 | Gene3D | G3DSA:1.20.1250.20 | MFS general substrate transporter like domains |
| 264 | 463 | InterPro | IPR036259 | MFS transporter superfamily |
| 21 | 457 | CDD | cd17321 | MFS_MMR_MDR_like |
| 75 | 85 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 355 | 359 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 56 | 74 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 437 | 457 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 410 | 431 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 296 | 306 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · FPocket
Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GM25
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_05446
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Bioactivity evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
No PDB ligands found through similar proteins.
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
| Ligand | UniProt (homolog) | pchembl | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 4YH ChEMBL | A0R5K5 | — | 454.6 Da LogP 5.09 TPSA 64.0 | 1 viol. | ✓ Clean |
CC(C)C(CCCN(C)CCc1ccc(c(c1)OC)OC)(C#N)c2ccc(c(c…
|
| CHEMBL1502567 ChEMBL | A0R5K5 | — | 196.2 Da LogP 1.85 TPSA 34.4 | ✓ Ro5 | ✓ Clean |
O=c1c2ccccc2nc2ccccn12
|
| CHEMBL224214 ChEMBL | A0R5K5 | — | 204.6 Da LogP 2.16 TPSA 72.0 | ✓ Ro5 | Alert |
N#CC(C#N)=NNc1cccc(Cl)c1
|
| CHEMBL4164617 ChEMBL | A0R5K5 | — | 265.1 Da LogP 3.15 TPSA 34.4 | ✓ Ro5 | ✓ Clean |
O=c1c2cccc(Cl)c2nc2c(Cl)cccn12
|
| CHEMBL4168026 ChEMBL | A0R5K5 | — | 232.2 Da LogP 2.13 TPSA 34.4 | ✓ Ro5 | ✓ Clean |
O=c1c2ccccc2nc2c(F)cc(F)cn12
|
| CHEMBL4169953 ChEMBL | A0R5K5 | — | 244.7 Da LogP 2.81 TPSA 34.4 | ✓ Ro5 | ✓ Clean |
Cc1cccn2c(=O)c3cccc(Cl)c3nc12
|
| CHEMBL4171005 ChEMBL | A0R5K5 | — | 230.7 Da LogP 2.50 TPSA 34.4 | ✓ Ro5 | ✓ Clean |
O=c1c2ccc(Cl)cc2nc2ccccn12
|
| CHEMBL4171337 ChEMBL | A0R5K5 | — | 210.2 Da LogP 2.16 TPSA 34.4 | ✓ Ro5 | ✓ Clean |
Cc1cccn2c(=O)c3ccccc3nc12
|
| CHEMBL4172500 ChEMBL | A0R5K5 | — | 248.6 Da LogP 2.64 TPSA 34.4 | ✓ Ro5 | ✓ Clean |
O=c1c2cccc(Cl)c2nc2ccc(F)cn12
|
| CHEMBL4172832 ChEMBL | A0R5K5 | — | 228.2 Da LogP 2.30 TPSA 34.4 | ✓ Ro5 | ✓ Clean |
Cc1ccn2c(=O)c3cccc(F)c3nc2c1
|
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC161387 ZINC | 1.000 | 204.6 Da LogP 2.16 TPSA 72.0 | ✓ Ro5 | Alert |
N#CC(C#N)=NNc1cccc(Cl)c1
|
| ZINC22056448 ZINC | 0.887 | 440.6 Da LogP 4.79 TPSA 75.0 | ✓ Ro5 | ✓ Clean |
COc1cc(CCN(C)CCC[C@](C#N)(c2ccc(OC)c(OC)c2)C(C)…
|
| ZINC22056453 ZINC | 0.887 | 440.6 Da LogP 4.79 TPSA 75.0 | ✓ Ro5 | ✓ Clean |
COc1cc(CCN(C)CCC[C@@](C#N)(c2ccc(OC)c(OC)c2)C(C…
|
| ZINC32272342 ZINC | 0.887 | 440.6 Da LogP 4.79 TPSA 75.0 | ✓ Ro5 | ✓ Clean |
COc1cc([C@](C#N)(CCCN(C)CCc2ccc(OC)c(OC)c2)C(C)…
|
| ZINC32272344 ZINC | 0.887 | 440.6 Da LogP 4.79 TPSA 75.0 | ✓ Ro5 | ✓ Clean |
COc1cc([C@@](C#N)(CCCN(C)CCc2ccc(OC)c(OC)c2)C(C…
|
| ZINC65739555 ZINC | 0.878 | 440.6 Da LogP 4.70 TPSA 64.0 | ✓ Ro5 | ✓ Clean |
COc1ccc(CCN(C)CC[C@](C#N)(c2ccc(OC)c(OC)c2)C(C)…
|
| ZINC65739557 ZINC | 0.878 | 440.6 Da LogP 4.70 TPSA 64.0 | ✓ Ro5 | ✓ Clean |
COc1ccc(CCN(C)CC[C@@](C#N)(c2ccc(OC)c(OC)c2)C(C…
|
| ZINC142261274 ZINC | 0.738 | 452.6 Da LogP 4.86 TPSA 71.8 | ✓ Ro5 | ✓ Clean |
COC(=O)c1cccc(CCN(C)CCC[C@@](C#N)(c2ccc(OC)c(OC…
|
| ZINC173252 ZINC | 0.692 | 275.1 Da LogP 2.61 TPSA 34.4 | ✓ Ro5 | ✓ Clean |
O=c1c2ccc(Br)cc2nc2ccccn12
|
| ZINC13492624 ZINC | 0.691 | 440.6 Da LogP 4.75 TPSA 72.7 | ✓ Ro5 | ✓ Clean |
COc1ccc(CCNCCC[C@](C#N)(c2ccc(OC)c(OC)c2)C(C)C)…
|
| ZINC6005366 ZINC | 0.691 | 440.6 Da LogP 4.75 TPSA 72.7 | ✓ Ro5 | ✓ Clean |
COc1ccc(CCNCCC[C@@](C#N)(c2ccc(OC)c(OC)c2)C(C)C…
|
| ZINC110918 ZINC | 0.688 | 239.1 Da LogP 2.81 TPSA 72.0 | ✓ Ro5 | Alert |
N#CC(C#N)=NNc1cc(Cl)cc(Cl)c1
|
| ZINC5591588 ZINC | 0.679 | 332.5 Da LogP 4.24 TPSA 45.5 | ✓ Ro5 | ✓ Clean |
CCN(CC)CCC[C@@](C#N)(c1ccc(OC)c(OC)c1)C(C)C
|
| ZINC6636716 ZINC | 0.679 | 332.5 Da LogP 4.24 TPSA 45.5 | ✓ Ro5 | ✓ Clean |
CCN(CC)CCC[C@](C#N)(c1ccc(OC)c(OC)c1)C(C)C
|
| ZINC1554503643 ZINC | 0.676 | 260.6 Da LogP 1.29 TPSA 106.1 | ✓ Ro5 | Alert |
N#CC(=O)C(=NNc1cccc(Cl)c1)C(=O)C#N
|
| ZINC113108578 ZINC | 0.667 | 484.6 Da LogP 4.86 TPSA 73.2 | ✓ Ro5 | ✓ Clean |
COc1ccc(CCN(C)CCC[C@](C#N)(c2ccc(OC)c(OC)c2)C(C…
|
| ZINC80809733 ZINC | 0.667 | 484.6 Da LogP 4.86 TPSA 73.2 | ✓ Ro5 | ✓ Clean |
COc1ccc(CCN(C)CCC[C@@](C#N)(c2ccc(OC)c(OC)c2)C(…
|
| ZINC4194526 ZINC | 0.657 | 249.1 Da LogP 2.26 TPSA 72.0 | ✓ Ro5 | Alert |
N#CC(C#N)=NNc1cccc(Br)c1
|
| ZINC5427363 ZINC | 0.647 | 239.1 Da LogP 2.81 TPSA 72.0 | ✓ Ro5 | Alert |
N#CC(C#N)=NNc1ccc(Cl)c(Cl)c1
|
| ZINC5761247 ZINC | 0.647 | 276.4 Da LogP 2.86 TPSA 68.3 | ✓ Ro5 | ✓ Clean |
COc1ccc([C@@](C#N)(CCCN)C(C)C)cc1OC
|
| ZINC5761472 ZINC | 0.647 | 276.4 Da LogP 2.86 TPSA 68.3 | ✓ Ro5 | ✓ Clean |
COc1ccc([C@](C#N)(CCCN)C(C)C)cc1OC
|
| ZINC801649 ZINC | 0.641 | 240.2 Da LogP 1.55 TPSA 71.7 | ✓ Ro5 | ✓ Clean |
O=C(O)c1cccn2c(=O)c3ccccc3nc12
|
| ZINC4454 ZINC | 0.632 | 240.2 Da LogP 1.55 TPSA 71.7 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc2nc3ccccn3c(=O)c2c1
|
| ZINC212661855 ZINC | 0.619 | 279.1 Da LogP 3.46 TPSA 34.4 | ✓ Ro5 | ✓ Clean |
Cc1cc(Cl)cc2c(=O)n3cccc(Cl)c3nc12
|
| ZINC271839 ZINC | 0.611 | 314.3 Da LogP 2.01 TPSA 68.7 | ✓ Ro5 | ✓ Clean |
O=c1c2ccccc2nc2n1ccc1nc3ccccc3c(=O)n12
|
| ZINC5761248 ZINC | 0.611 | 290.4 Da LogP 3.12 TPSA 54.3 | ✓ Ro5 | ✓ Clean |
CNCCC[C@](C#N)(c1ccc(OC)c(OC)c1)C(C)C
|
| ZINC5761473 ZINC | 0.611 | 290.4 Da LogP 3.12 TPSA 54.3 | ✓ Ro5 | ✓ Clean |
CNCCC[C@@](C#N)(c1ccc(OC)c(OC)c1)C(C)C
|
| ZINC27859086 ZINC | 0.605 | 240.2 Da LogP 1.55 TPSA 71.7 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccn2c(=O)c3ccccc3nc2c1
|
| ZINC495173 ZINC | 0.605 | 238.2 Da LogP 2.52 TPSA 72.0 | ✓ Ro5 | Alert |
N#CC(C#N)=NNc1cccc(C(F)(F)F)c1
|
| ZINC51317291 ZINC | 0.604 | 343.4 Da LogP 3.09 TPSA 63.5 | ✓ Ro5 | ✓ Clean |
Cc1ccccc1CNC(=O)c1cccn2c(=O)c3ccccc3nc12
|
| ZINC34109759 ZINC | 0.596 | 272.3 Da LogP 3.42 TPSA 66.0 | ✓ Ro5 | ✓ Clean |
COc1ccc([C@@](C#N)(CCC#N)C(C)C)cc1OC
|
| ZINC34109761 ZINC | 0.596 | 272.3 Da LogP 3.42 TPSA 66.0 | ✓ Ro5 | ✓ Clean |
COc1ccc([C@](C#N)(CCC#N)C(C)C)cc1OC
|
| ZINC13111736 ZINC | 0.595 | 283.7 Da LogP 3.51 TPSA 65.2 | ✓ Ro5 | Alert |
N#C/C(=N\Nc1cccc(Cl)c1)C(=O)c1ccccc1
|
| ZINC353283 ZINC | 0.595 | 318.2 Da LogP 4.17 TPSA 65.2 | ✓ Ro5 | Alert |
N#C/C(=N/Nc1cccc(Cl)c1)C(=O)c1ccc(Cl)cc1
|
| ZINC501290 ZINC | 0.590 | 202.6 Da LogP 3.14 TPSA 17.3 | ✓ Ro5 | ✓ Clean |
Clc1ccc2nc3ccccn3c2c1
|
| ZINC26511213 ZINC | 0.585 | 208.6 Da LogP 1.96 TPSA 34.4 | ✓ Ro5 | ✓ Clean |
Cc1nc2c(C)cccn2c(=O)c1Cl
|
| ZINC271843 ZINC | 0.585 | 328.3 Da LogP 2.32 TPSA 68.7 | ✓ Ro5 | ✓ Clean |
Cc1cn2c(=O)c3ccccc3nc2n2c(=O)c3ccccc3nc12
|
| ZINC5711982 ZINC | 0.583 | 380.5 Da LogP 4.75 TPSA 45.5 | ✓ Ro5 | ✓ Clean |
COc1ccc(CCN(C)CCC[C@@](C)(C#N)c2ccccc2C)cc1OC
|
| ZINC5712021 ZINC | 0.583 | 380.5 Da LogP 4.75 TPSA 45.5 | ✓ Ro5 | ✓ Clean |
COc1ccc(CCN(C)CCC[C@](C)(C#N)c2ccccc2C)cc1OC
|
| ZINC8681082 ZINC | 0.583 | 201.7 Da LogP 1.91 TPSA 50.4 | ✓ Ro5 | ✓ Clean |
N/C(S)=N\Nc1cccc(Cl)c1
|
| ZINC103743941 ZINC | 0.581 | 318.2 Da LogP 4.17 TPSA 65.2 | ✓ Ro5 | Alert |
N#C/C(=N\Nc1cccc(Cl)c1)C(=O)c1ccccc1Cl
|
| ZINC3643560 ZINC | 0.579 | 240.2 Da LogP 1.55 TPSA 71.7 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc2nc3ccccc3c(=O)n2c1
|
| ZINC493799 ZINC | 0.575 | 215.2 Da LogP 1.41 TPSA 115.1 | ✓ Ro5 | Alert |
N#CC(C#N)=NNc1cccc([N+](=O)[O-])c1
|
| ZINC2870883 ZINC | 0.571 | 239.1 Da LogP 2.81 TPSA 72.0 | ✓ Ro5 | Alert |
N#CC(C#N)=NNc1c(Cl)cccc1Cl
|
| ZINC95831398 ZINC | 0.571 | 209.6 Da LogP 1.24 TPSA 60.4 | ✓ Ro5 | ✓ Clean |
Cc1cccn2c(=O)c(N)c(Cl)nc12
|
| ZINC1019749 ZINC | 0.568 | 257.2 Da LogP 1.19 TPSA 76.6 | ✓ Ro5 | ✓ Clean |
Cc1cccn2c(=O)c3cc(C(=O)O)n(C)c3nc12
|
| ZINC6809441 ZINC | 0.566 | 362.8 Da LogP 2.83 TPSA 80.2 | ✓ Ro5 | ✓ Clean |
Cc1cccn2c(=O)c3cc(C#N)c(=O)n(-c4ccccc4Cl)c3nc12
|
| ZINC35462737 ZINC | 0.565 | 274.7 Da LogP 2.20 TPSA 71.7 | ✓ Ro5 | ✓ Clean |
O=C(O)c1cccn2c(=O)c3ccc(Cl)cc3nc12
|
| ZINC22057892 ZINC | 0.561 | 412.5 Da LogP 4.28 TPSA 64.0 | ✓ Ro5 | ✓ Clean |
COc1ccc(CCN(C)CCC[C@@H](C#N)c2ccc(OC)c(OC)c2)cc…
|
| ZINC22057896 ZINC | 0.561 | 412.5 Da LogP 4.28 TPSA 64.0 | ✓ Ro5 | ✓ Clean |
COc1ccc(CCN(C)CCC[C@H](C#N)c2ccc(OC)c(OC)c2)cc1…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.