Protein target profile

KP13_05435

putative permease

Genome: KpKP13 Gene: AHE44974.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GW71

Export view

Length 459

Pocket druggability 0.855

Direct ligand evidence 0 55 total records

Functional annotation 0 EC 4 GO

Target summary

Strong target candidate with converging metabolic, structural and chemical evidence.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Main supporting evidence

Independent pocket support: FPocket + P2Rank Both predictors report a high-scoring binding site (FPocket 0.85, P2Rank 0.95). Use the 3D pocket comparison to verify whether they identify the same site. No similar human protein detected The current BLAST sequence screen did not find a significant human match, lowering apparent off-target risk. Core gene across strains Marked as conserved by both pan-genome tools: Roary and CoreCruncher. Strong predicted binding pocket FPocket selected-pocket score 0.85. This is a computational pocket signal, not binding validation. Review the complete evidence below

Risks to review

Evidence gaps

No metabolic context No SBML/network-derived reaction evidence is loaded for this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target: No hit
Gut microbiome similarity: 0.7% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG): N
DEG identity (%): 0.0 Higher values support similarity to known essential genes.

Localization

Localization: CytoplasmicMembrane

Structure confidence

ColabFold pLDDT: 91.46 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.855

Structure A0A0H3GW71

Pocket Pocket 2

P2Rank 0.953

Structure A0A0H3GW71

Pocket Pocket 1

ColabFold model

FPocket 0.75 · Pocket 2

P2Rank 0.941 · Pocket 1

Core conservation Conserved core gene

Roary core

CoreCruncher core

Gut microbiome 31 / 4744 genomes with a hit

Prevalence 0.7%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

UniProt A0A0H3GW71

Sequence

Primary amino-acid sequence viewer.

MSERRSIDYIPESERHGHPFSQFTLWFGGNLQITAIVTGALAVVLGGDVVWSLVGLLVGQMLGAAVMSLHALQGPRLGLPQMILSRAQFGVFGAVVPLVLVCVMYIGFSASGTVLAGQAMAKLLNISHVAGMLIFSAIIIVIAVLGYKVIHKLGKLASIVGILAFVYMFITLLLSADLSALAHNNHFSLPTFLLAVSLSSSWQIAFCPYVSDYSRYLPRDVSATKTWCSVFFGTVLGTQTSMTLGVLTAAIAGSAFPGHEVSYLVGLGKSQAMAMVIYFAICFGKITFTTLNAYGSFMSLTTIVSAFRRQTVLSQKCRIAFVVLMVTASCIIALLSEPAFLKHFTHFLLFLLAFFVPWSAICLTDYYLISKGAIDIPALSDPQQRYGFWNLYAITLYIVGVLIQLPFIENPLFHGSLTWIFAGNDVSWIIGWFGTGVLYYALRRFDRRSLPAQSLFPST

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

4 GO

Gene Ontology (GO)

GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
GO:0022857 Enables the transfer of a substance, usually a specific substance or a group of related substances, from one side of a membrane to the other.
GO:0055085 The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other.
GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

45 records

Show feature table

Start	End	DB	Term	Name
319	341	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.
49	69	Phobius	TRANSMEMBRANE	Region of a membrane-bound protein predicted to be embedded in the membrane.
50	72	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.
70	88	Phobius	CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
156	178	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.
188	210	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.
230	256	Phobius	TRANSMEMBRANE	Region of a membrane-bound protein predicted to be embedded in the membrane.
23	45	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.
109	127	Phobius	NON_CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
89	108	Phobius	TRANSMEMBRANE	Region of a membrane-bound protein predicted to be embedded in the membrane.
276	298	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.
347	368	Phobius	TRANSMEMBRANE	Region of a membrane-bound protein predicted to be embedded in the membrane.
128	149	Phobius	TRANSMEMBRANE	Region of a membrane-bound protein predicted to be embedded in the membrane.
386	408	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.
211	229	Phobius	CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
418	440	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.
1	22	Phobius	CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
156	175	Phobius	TRANSMEMBRANE	Region of a membrane-bound protein predicted to be embedded in the membrane.
389	407	Phobius	TRANSMEMBRANE	Region of a membrane-bound protein predicted to be embedded in the membrane.
92	114	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.
1	454	PIRSF	PIRSF002744	Pur-cyt_permease
1	454	InterPro	IPR026030	Purine-cytosine permease Fcy2/21/22
369	388	Phobius	CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
276	307	Phobius	TRANSMEMBRANE	Region of a membrane-bound protein predicted to be embedded in the membrane.
347	369	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.
44	48	Phobius	NON_CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
187	210	Phobius	TRANSMEMBRANE	Region of a membrane-bound protein predicted to be embedded in the membrane.
230	252	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.
408	418	Phobius	NON_CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
129	151	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.
419	442	Phobius	TRANSMEMBRANE	Region of a membrane-bound protein predicted to be embedded in the membrane.
176	186	Phobius	NON_CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
3	449	PANTHER	PTHR31806	PURINE-CYTOSINE PERMEASE FCY2-RELATED
3	449	InterPro	IPR026030	Purine-cytosine permease Fcy2/21/22
443	459	Phobius	CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
308	318	Phobius	CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
319	341	Phobius	TRANSMEMBRANE	Region of a membrane-bound protein predicted to be embedded in the membrane.
23	43	Phobius	TRANSMEMBRANE	Region of a membrane-bound protein predicted to be embedded in the membrane.
3	442	Gene3D	G3DSA:1.10.4160.10	Hydantoin permease
11	448	CDD	cd11484	SLC-NCS1sbd_CobB-like
9	431	Pfam	PF02133	Permease for cytosine/purines, uracil, thiamine, allantoin
9	431	InterPro	IPR001248	Purine-cytosine permease
342	346	Phobius	NON_CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
150	155	Phobius	CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
257	275	Phobius	NON_CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low

How colors and pocket overlays are used

Uniform protein color marks the displayed model as a single molecular object.

Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.

Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.

'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.

'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.

'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.

Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Site 1 FPocket #2

0.855

Show in viewer

Surrounding area

Site 2 FPocket #9

0.571

Unusual size

Show in viewer

Surrounding area

Site 3 FPocket #1

0.518

Likely same site as P2Rank 1 6.5 Å 11 shared residues 92% of smaller site

Show in viewer

Surrounding area

Site 4 FPocket #17

0.508

Show in viewer

Surrounding area

Binding pockets · P2Rank

Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Site 1 P2Rank #1

0.953

Likely same site as FPocket 1 6.5 Å 11 shared residues 92% of smaller site

Show in viewer

Surrounding area

Site 2 P2Rank #2

0.411

Show in viewer

Surrounding area

Site 3 P2Rank #3

0.276

Show in viewer

Surrounding area

Site 4 P2Rank #4

0.214

Show in viewer

Surrounding area

Site 5 P2Rank #5

0.127

Show in viewer

Surrounding area

Binding pockets · FPocket

Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Site 1 FPocket #2

0.75

Likely same site as P2Rank 3 1.0 Å 8 shared residues 100% of smaller site

Show in viewer

Surrounding area

Site 2 FPocket #1

0.605

Unusual size

Show in viewer

Surrounding area

Site 3 FPocket #10

0.4

Show in viewer

Surrounding area

Binding pockets · P2Rank

Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Site 1 P2Rank #1

0.941

Show in viewer

Surrounding area

Site 2 P2Rank #2

0.411

Show in viewer

Surrounding area

Site 3 P2Rank #3

0.226

Likely same site as FPocket 2 1.0 Å 8 shared residues 100% of smaller site

Show in viewer

Surrounding area

Site 4 P2Rank #4

0.174

Show in viewer

Surrounding area

Site 5 P2Rank #5

0.146

Show in viewer

Surrounding area

All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold DB AF_A0A0H3GW71	AlphaFold DB	—	—	full sequence	—	Viewing
ColabFold KP13_05435	ColabFold	—	—	full sequence	—	Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

55 records

Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records

Transferred evidence 5 records from similar proteins

Structural ligands 5 0 loaded crystals

Measured bioactivity 0 direct and transferred ChEMBL records

Proposed compounds 50 similarity-based ZINC candidates

Best available ligand signal

5FH PDB via homolog 190.2 Da · LogP 0.44 · TPSA 58.2 Open detail RCSB PDB

5ND PDB via homolog Detail RCSB PDB

5NL PDB via homolog Detail RCSB PDB

B5H PDB via homolog Detail RCSB PDB

I5H PDB via homolog Detail RCSB PDB

Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.

No PDB structure with a co-crystallized ligand found for this exact protein.

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Ligand	Source crystal	UniProt (homolog)	MW · LogP · TPSA	Lipinski	PAINS	SMILES
5FH RCSB PDB	4D1B	D6R8X8	190.2 Da LogP 0.44 TPSA 58.2	✓ Ro5	✓ Clean	`c1ccc(cc1)C[C@H]2C(=O)NC(=O)N2`
5ND RCSB PDB	4D1D	D6R8X8	240.3 Da LogP 1.59 TPSA 58.2	✓ Ro5	✓ Clean	`c1ccc2cc(ccc2c1)C[C@@H]3C(=O)NC(=O)N3`
5NL RCSB PDB	4D1D	D6R8X8	240.3 Da LogP 1.59 TPSA 58.2	✓ Ro5	✓ Clean	`c1ccc2cc(ccc2c1)C[C@H]3C(=O)NC(=O)N3`
B5H RCSB PDB	4D1C	D6R8X8	267.1 Da LogP 1.63 TPSA 58.2	✓ Ro5	✓ Clean	`c1cc(cc(c1)Br)/C=C\2/C(=O)NC(=O)N2`
I5H RCSB PDB	4D1A	D6R8X8	229.2 Da LogP 0.92 TPSA 74.0	✓ Ro5	✓ Clean	`c1ccc2c(c1)c(c[nH]2)C[C@H]3C(=O)NC(=O)N3`

Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).

No ChEMBL bioactivity data found for this exact protein.

Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).

No ChEMBL hits found through similar proteins.

Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).

Ligand	Tanimoto	MW · LogP · TPSA	Lipinski	PAINS	SMILES
ZINC1093415 ZINC	1.000	267.1 Da LogP 1.63 TPSA 58.2	✓ Ro5	✓ Clean	`O=C1NC(=O)/C(=C\c2cccc(Br)c2)N1`
ZINC16386114 ZINC	1.000	267.1 Da LogP 1.63 TPSA 58.2	✓ Ro5	✓ Clean	`O=C1NC(=O)/C(=C/c2cccc(Br)c2)N1`
ZINC1682922 ZINC	1.000	229.2 Da LogP 0.92 TPSA 74.0	✓ Ro5	✓ Clean	`O=C1NC(=O)[C@H](Cc2c[nH]c3ccccc23)N1`
ZINC2043051 ZINC	1.000	229.2 Da LogP 0.92 TPSA 74.0	✓ Ro5	✓ Clean	`O=C1NC(=O)[C@@H](Cc2c[nH]c3ccccc23)N1`
ZINC18209074 ZINC	0.800	372.4 Da LogP 2.42 TPSA 89.8	✓ Ro5	✓ Clean	`O=C1N[C@H](Cc2c[nH]c3ccccc23)C(=O)N[C@H]1Cc1c[n…`
ZINC2113938 ZINC	0.800	372.4 Da LogP 2.42 TPSA 89.8	✓ Ro5	✓ Clean	`O=C1N[C@H](Cc2c[nH]c3ccccc23)C(=O)N[C@@H]1Cc1c[…`
ZINC4073922 ZINC	0.800	372.4 Da LogP 2.42 TPSA 89.8	✓ Ro5	✓ Clean	`O=C1N[C@@H](Cc2c[nH]c3ccccc23)C(=O)N[C@H]1Cc1c[…`
ZINC28526335 ZINC	0.750	245.3 Da LogP 1.08 TPSA 56.9	✓ Ro5	✓ Clean	`O=C1NC(=S)N[C@@H]1Cc1c[nH]c2ccccc12`
ZINC28526336 ZINC	0.750	245.3 Da LogP 1.08 TPSA 56.9	✓ Ro5	✓ Clean	`O=C1NC(=S)N[C@H]1Cc1c[nH]c2ccccc12`
ZINC18061788 ZINC	0.741	294.4 Da LogP 1.45 TPSA 58.2	✓ Ro5	✓ Clean	`O=C1N[C@H](Cc2ccccc2)C(=O)N[C@H]1Cc1ccccc1`
ZINC2038712 ZINC	0.741	294.4 Da LogP 1.45 TPSA 58.2	✓ Ro5	✓ Clean	`O=C1N[C@@H](Cc2ccccc2)C(=O)N[C@H]1Cc1ccccc1`
ZINC2038715 ZINC	0.741	294.4 Da LogP 1.45 TPSA 58.2	✓ Ro5	✓ Clean	`O=C1N[C@H](Cc2ccccc2)C(=O)N[C@@H]1Cc1ccccc1`
ZINC15773085 ZINC	0.722	283.1 Da LogP 1.79 TPSA 41.1	✓ Ro5	✓ Clean	`O=C1NC(=S)N/C1=C\c1cccc(Br)c1`
ZINC1669933 ZINC	0.710	224.6 Da LogP 1.09 TPSA 58.2	✓ Ro5	✓ Clean	`O=C1NC(=O)[C@H](Cc2ccc(Cl)cc2)N1`
ZINC2045152 ZINC	0.710	224.6 Da LogP 1.09 TPSA 58.2	✓ Ro5	✓ Clean	`O=C1NC(=O)[C@@H](Cc2ccc(Cl)cc2)N1`
ZINC5769509 ZINC	0.710	208.2 Da LogP 0.58 TPSA 58.2	✓ Ro5	✓ Clean	`O=C1NC(=O)[C@@H](Cc2ccc(F)cc2)N1`
ZINC5769537 ZINC	0.710	208.2 Da LogP 0.58 TPSA 58.2	✓ Ro5	✓ Clean	`O=C1NC(=O)[C@H](Cc2ccc(F)cc2)N1`
ZINC13430262 ZINC	0.700	273.3 Da LogP -0.31 TPSA 94.2	✓ Ro5	✓ Clean	`O=C1N[C@H](CO)C(=O)N[C@H]1Cc1c[nH]c2ccccc12`
ZINC13430264 ZINC	0.700	273.3 Da LogP -0.31 TPSA 94.2	✓ Ro5	✓ Clean	`O=C1N[C@H](Cc2c[nH]c3ccccc23)C(=O)N[C@H]1CO`
ZINC13430265 ZINC	0.700	273.3 Da LogP -0.31 TPSA 94.2	✓ Ro5	✓ Clean	`O=C1N[C@@H](Cc2c[nH]c3ccccc23)C(=O)N[C@H]1CO`
ZINC2560888 ZINC	0.700	333.4 Da LogP 1.94 TPSA 74.0	✓ Ro5	✓ Clean	`O=C1N[C@H](Cc2c[nH]c3ccccc23)C(=O)N[C@@H]1Cc1cc…`
ZINC4899716 ZINC	0.700	333.4 Da LogP 1.94 TPSA 74.0	✓ Ro5	✓ Clean	`O=C1N[C@@H](Cc2c[nH]c3ccccc23)C(=O)N[C@H]1Cc1cc…`
ZINC6096559 ZINC	0.700	333.4 Da LogP 1.94 TPSA 74.0	✓ Ro5	✓ Clean	`O=C1N[C@H](Cc2ccccc2)C(=O)N[C@H]1Cc1c[nH]c2cccc…`
ZINC6096622 ZINC	0.700	333.4 Da LogP 1.94 TPSA 74.0	✓ Ro5	✓ Clean	`O=C1N[C@H](Cc2c[nH]c3ccccc23)C(=O)N[C@H]1Cc1ccc…`
ZINC1754395 ZINC	0.688	204.2 Da LogP 0.75 TPSA 58.2	✓ Ro5	✓ Clean	`Cc1ccc(C[C@H]2NC(=O)NC2=O)cc1`
ZINC2034264 ZINC	0.688	204.2 Da LogP 0.75 TPSA 58.2	✓ Ro5	✓ Clean	`Cc1ccc(C[C@@H]2NC(=O)NC2=O)cc1`
ZINC3290147 ZINC	0.688	204.2 Da LogP 0.83 TPSA 58.2	✓ Ro5	✓ Clean	`O=C1NC(=O)[C@H](CCc2ccccc2)N1`
ZINC3290149 ZINC	0.688	204.2 Da LogP 0.83 TPSA 58.2	✓ Ro5	✓ Clean	`O=C1NC(=O)[C@@H](CCc2ccccc2)N1`
ZINC410261 ZINC	0.688	206.2 Da LogP 0.14 TPSA 78.4	✓ Ro5	✓ Clean	`O=C1NC(=O)[C@H](Cc2ccc(O)cc2)N1`
ZINC410262 ZINC	0.688	206.2 Da LogP 0.14 TPSA 78.4	✓ Ro5	✓ Clean	`O=C1NC(=O)[C@@H](Cc2ccc(O)cc2)N1`
ZINC5589124 ZINC	0.688	205.2 Da LogP 0.02 TPSA 84.2	✓ Ro5	Alert	`Nc1ccc(C[C@H]2NC(=O)NC2=O)cc1`
ZINC5589126 ZINC	0.688	205.2 Da LogP 0.02 TPSA 84.2	✓ Ro5	Alert	`Nc1ccc(C[C@@H]2NC(=O)NC2=O)cc1`
ZINC6096554 ZINC	0.688	206.3 Da LogP 0.60 TPSA 41.1	✓ Ro5	✓ Clean	`O=C1NC(=S)N[C@@H]1Cc1ccccc1`
ZINC6096619 ZINC	0.688	206.3 Da LogP 0.60 TPSA 41.1	✓ Ro5	✓ Clean	`O=C1NC(=S)N[C@H]1Cc1ccccc1`
ZINC12341748 ZINC	0.686	222.6 Da LogP 1.52 TPSA 58.2	✓ Ro5	✓ Clean	`O=C1NC(=O)/C(=C\c2cccc(Cl)c2)N1`
ZINC13413571 ZINC	0.683	257.3 Da LogP 0.71 TPSA 74.0	✓ Ro5	✓ Clean	`C[C@@H]1NC(=O)[C@H](Cc2c[nH]c3ccccc23)NC1=O`
ZINC247754165 ZINC	0.674	300.4 Da LogP 0.43 TPSA 100.0	✓ Ro5	✓ Clean	`NCCC[C@@H]1NC(=O)[C@@H](Cc2c[nH]c3ccccc23)NC1=O`
ZINC34114304 ZINC	0.674	245.2 Da LogP 0.62 TPSA 94.2	✓ Ro5	✓ Clean	`O=C1NC(=O)[C@H](Cc2c[nH]c3ccc(O)cc23)N1`
ZINC100662888 ZINC	0.667	204.2 Da LogP 0.57 TPSA 78.4	✓ Ro5	✓ Clean	`O=C1NC(=O)/C(=C/c2cccc(O)c2)N1`
ZINC12410471 ZINC	0.667	202.2 Da LogP 1.18 TPSA 58.2	✓ Ro5	✓ Clean	`Cc1cccc(/C=C2\NC(=O)NC2=O)c1`
ZINC13139308 ZINC	0.667	204.2 Da LogP 0.57 TPSA 78.4	✓ Ro5	✓ Clean	`O=C1NC(=O)/C(=C\c2cccc(O)c2)N1`
ZINC1875304352 ZINC	0.667	297.4 Da LogP 1.49 TPSA 74.0	✓ Ro5	✓ Clean	`O=C1N[C@H](Cc2c[nH]c3ccccc23)C(=O)N[C@H]1CC1CC1`
ZINC2069462964 ZINC	0.667	297.4 Da LogP 1.49 TPSA 74.0	✓ Ro5	✓ Clean	`O=C1N[C@@H](CC2CC2)C(=O)N[C@H]1Cc1c[nH]c2ccccc12`
ZINC208759478 ZINC	0.667	319.4 Da LogP 2.07 TPSA 74.0	✓ Ro5	✓ Clean	`O=C1N[C@H](Cc2c[nH]c3ccccc23)C(=O)N[C@H]1c1cccc…`
ZINC208759513 ZINC	0.667	319.4 Da LogP 2.07 TPSA 74.0	✓ Ro5	✓ Clean	`O=C1N[C@@H](c2ccccc2)C(=O)N[C@H]1Cc1c[nH]c2cccc…`
ZINC2819805 ZINC	0.667	218.2 Da LogP 0.21 TPSA 75.3	✓ Ro5	✓ Clean	`O=C1NC(=O)C(Cc2ccccc2)C(=O)N1`
ZINC39365597 ZINC	0.667	319.4 Da LogP 2.07 TPSA 74.0	✓ Ro5	✓ Clean	`O=C1N[C@H](c2ccccc2)C(=O)N[C@H]1Cc1c[nH]c2ccccc…`
ZINC670451826 ZINC	0.667	283.3 Da LogP 1.10 TPSA 74.0	✓ Ro5	✓ Clean	`O=C1N[C@H](Cc2c[nH]c3ccccc23)C(=O)N[C@H]1C1CC1`
ZINC72182 ZINC	0.667	206.2 Da LogP 1.01 TPSA 58.2	✓ Ro5	✓ Clean	`O=C1NC(=O)/C(=C\c2cccc(F)c2)N1`
ZINC828321135 ZINC	0.667	283.3 Da LogP 1.10 TPSA 74.0	✓ Ro5	✓ Clean	`O=C1N[C@@H](C2CC2)C(=O)N[C@H]1Cc1c[nH]c2ccccc12`

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.