KpKP13 Protein target profile

Tryptophan synthase alpha chain

Accession: KP13_05359

Gene: trpA AHE45006.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GRN0
Length 269
Pocket druggability (P2Rank · AlphaFold DB model) 0.791
Direct ligand evidence 0 87 total records
Functional annotation 0 EC 2 GO
Target summary

Strong target candidate with converging metabolic, structural and chemical evidence.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
3.3% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
57.09 Higher values support similarity to known essential genes.
DEG E-value
5.04e-105 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
95.51 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.791
Structure A0A0H3GRN0
Pocket Pocket 1
Druggability (FPocket) 0.928
Structure A0A0H3GRN0
Pocket Pocket 1
ColabFold model
P2Rank 0.833 · Pocket 1
FPocket 0.523 · Pocket 2
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 158 / 4744 genomes with a hit
Prevalence 3.3%

Sequence

Primary amino-acid sequence viewer.

MERYETLFAQLKNRQEGAFVPFVTLGDPGPEQSLKIIDALIEGGADALELGIPFSDPLADGPTIQGAALRAFAAGVTPAQCFEMLASIRQKHPTIPIGLLMYANLVFSPGIDAFYAQCARVGVDSVLVADVPVEESAPFRQAAMRHNIAPIFICPPNADDDLLRQISSYGRGYTYLLSRAGVTGAENRAALPLHHLVEKLAEYHAAPPLQGFGISAPEQVSAAIDAGAAGAISGSAIVKIIERHLDEPQTMLDELKAFVQSLKAATKTA

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

2 GO

Subcellular localization

Localization
Cytoplasmic

Gene Ontology (GO)

2
  • GO:0004834 Catalysis of the reaction: L-serine + (1S,2R)-1-C-(indol-3-yl)glycerol 3-phosphate = L-tryptophan + glyceraldehyde 3-phosphate + H2O.
  • GO:0006568 The chemical reactions and pathways involving tryptophan, the chiral amino acid 2-amino-3-(1H-indol-3-yl)propanoic acid.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

17 records
Show feature table
Start End DB Term Name
1 268 Gene3D G3DSA:3.20.20.70 Aldolase class I
1 268 InterPro IPR013785 Aldolase-type TIM barrel
8 266 Pfam PF00290 Tryptophan synthase alpha chain
8 266 InterPro IPR002028 Tryptophan synthase, alpha chain
12 265 Hamap MF_00131 Tryptophan synthase alpha chain [trpA].
12 265 InterPro IPR002028 Tryptophan synthase, alpha chain
48 61 ProSitePatterns PS00167 Tryptophan synthase alpha chain signature.
48 61 InterPro IPR018204 Tryptophan synthase, alpha chain, active site
4 266 PANTHER PTHR43406 TRYPTOPHAN SYNTHASE, ALPHA CHAIN
4 266 InterPro IPR002028 Tryptophan synthase, alpha chain
18 263 CDD cd04724 Tryptophan_synthase_alpha
18 263 InterPro IPR002028 Tryptophan synthase, alpha chain
8 263 NCBIfam TIGR00262 tryptophan synthase subunit alpha
8 263 InterPro IPR002028 Tryptophan synthase, alpha chain
1 266 SUPERFAMILY SSF51366 Ribulose-phoshate binding barrel
1 266 InterPro IPR011060 Ribulose-phosphate binding barrel
1 268 FunFam G3DSA:3.20.20.70:FF:000037 Tryptophan synthase alpha chain

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.791
Likely same site as FPocket 1 1.9 Å 16 shared residues 84% of smaller site
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #1
0.928
Likely same site as P2Rank 1 1.9 Å 16 shared residues 84% of smaller site
Show in viewer
Surrounding area
Pocket 2 FPocket #6
0.493
Show in viewer
Surrounding area
Residue sets
UniProt: Active site:49-49 Proton acceptor
UniProt: Active site:60-60 Proton acceptor
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GRN0
AlphaFold DB full sequence Viewing
ColabFold KP13_05359
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

87 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 37 records from similar proteins
Structural ligands 37 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
0JO PDB via homolog 316.2 Da · LogP 0.72 · TPSA 149.5 Open detail RCSB PDB
13P PDB via homolog Detail RCSB PDB
1D0 PDB via homolog Detail RCSB PDB
79V PDB via homolog Detail RCSB PDB
7MN PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
0JO RCSB PDB P00929 316.2 Da LogP 0.72 TPSA 149.5 ✓ Ro5 ✓ Clean Cc1c(c(c(cn1)COP(=O)(O)O)/C=N/C(=C)C(=O)O)O
13P RCSB PDB P00929 170.1 Da LogP -1.34 TPSA 104.1 ✓ Ro5 ✓ Clean C(C(=O)COP(=O)(O)O)O
1D0 RCSB PDB P00929 425.3 Da LogP 1.55 TPSA 181.8 1 viol. ✓ Clean Cc1c(c(c(cn1)COP(=O)(O)O)C/N=C(\CNc2ccccc2O)/C(…
79V RCSB PDB P9WFY1 282.3 Da LogP 2.43 TPSA 56.0 ✓ Ro5 ✓ Clean c1ccc(c(c1)c2ccc(cc2)C3C(NC3C#N)CO)F
7MN RCSB PDB P00929 436.4 Da LogP -0.07 TPSA 153.5 1 viol. ✓ Clean CC1=C(/C(=C\[NH+]=C(/C[N@@]2CCc3c2cccc3)\C(=O)O…
AQ3 RCSB PDB P00929 427.4 Da LogP 1.07 TPSA 181.5 1 viol. ✓ Clean Cc1c(c(c(cn1)COP(=O)(O)O)CN[C@H](CNc2ccccc2O)C(…
BZI RCSB PDB P00929 118.1 Da LogP 1.56 TPSA 28.7 ✓ Ro5 ✓ Clean c1ccc2c(c1)[nH]cn2
F6F RCSB PDB P00929 329.2 Da LogP 1.42 TPSA 105.1 ✓ Ro5 ✓ Clean c1cc(ccc1C(=O)NCCOP(=O)(O)O)OC(F)(F)F
F9F RCSB PDB P00929 365.2 Da LogP 0.97 TPSA 122.2 ✓ Ro5 ✓ Clean c1cc(ccc1OC(F)(F)F)S(=O)(=O)NCCOP(=O)(O)O
FIP RCSB PDB P00929 273.2 Da LogP 2.35 TPSA 82.6 ✓ Ro5 ✓ Clean c1cc2c(cc1F)c(c[nH]2)CCCOP(=O)(O)O
G3P RCSB PDB P50382 172.1 Da LogP -1.55 TPSA 107.2 ✓ Ro5 ✓ Clean C([C@H](COP(=O)(O)O)O)O
H9V RCSB PDB P9WFY1 336.7 Da LogP 4.20 TPSA 35.8 ✓ Ro5 ✓ Clean c1cc(ccc1c2c(cc(cc2F)Cl)F)C3C(NC3C#N)CF
HDJ RCSB PDB P9WFY1 316.3 Da LogP 3.86 TPSA 35.8 ✓ Ro5 ✓ Clean Cc1cc(c(c(c1)F)c2ccc(cc2)C3C(NC3C#N)CF)F
HE1 RCSB PDB P00929 260.3 Da LogP 2.57 TPSA 77.8 ✓ Ro5 ✓ Clean c1ccc(c(c1)O)SCC\C=C\P(=O)(O)O
HF1 RCSB PDB P00929 278.2 Da LogP 2.70 TPSA 77.8 ✓ Ro5 ✓ Clean c1cc(c(cc1F)SCCC=CP(=O)(O)O)O
HPF RCSB PDB P00929 279.2 Da LogP -0.41 TPSA 139.5 1 viol. ✓ Clean c1ccc(c(c1)N[C@@H]([C@@H](COP(=O)(O)O)O)O)O
HSP RCSB PDB P00929 278.3 Da LogP 1.46 TPSA 94.8 ✓ Ro5 ✓ Clean c1ccc(c(c1)O)[S@](=O)CCCCP(=O)(O)O
IAD RCSB PDB P00929 290.3 Da LogP 0.75 TPSA 119.5 ✓ Ro5 ✓ Clean c1ccc2c(c1)c(c[nH]2)CC(=O)N[C@@H](CC(=O)O)C(=O)O
IAG RCSB PDB P00929 232.2 Da LogP 0.91 TPSA 82.2 ✓ Ro5 ✓ Clean c1ccc2c(c1)c(c[nH]2)CC(=O)NCC(=O)O
IAV RCSB PDB P00929 274.3 Da LogP 1.94 TPSA 82.2 ✓ Ro5 ✓ Clean CC(C)[C@@H](C(=O)O)NC(=O)Cc1c[nH]c2c1cccc2
IDM RCSB PDB P00929 119.2 Da LogP 1.65 TPSA 12.0 ✓ Ro5 ✓ Clean c1ccc2c(c1)CCN2
IGP RCSB PDB P00929 287.2 Da LogP 0.67 TPSA 123.0 ✓ Ro5 ✓ Clean c1ccc2c(c1)c(c[nH]2)[C@@H]([C@@H](COP(=O)(O)O)O…
IPL RCSB PDB P00929 255.2 Da LogP 2.21 TPSA 82.6 ✓ Ro5 ✓ Clean c1ccc2c(c1)c(c[nH]2)CCCOP(=O)(O)O
KOU RCSB PDB P00929 334.2 Da LogP -0.43 TPSA 169.8 ✓ Ro5 ✓ Clean Cc1c(c(c(cn1)COP(=O)(O)O)/C=N/C(CO)C(=O)O)O
MH6 RCSB PDB P00929 103.1 Da LogP -0.92 TPSA 81.4 ✓ Ro5 ✓ Clean [H]/N=C(\CO)/C(=O)O
MLA RCSB PDB P42390 104.1 Da LogP -0.45 TPSA 74.6 ✓ Ro5 ✓ Clean C(C(=O)O)C(=O)O
MLI RCSB PDB P9WFY1 102.0 Da LogP -3.12 TPSA 80.3 ✓ Ro5 ✓ Clean C(C(=O)[O-])C(=O)[O-]
MLT RCSB PDB P9WFY1 134.1 Da LogP -1.09 TPSA 94.8 ✓ Ro5 ✓ Clean C([C@H](C(=O)O)O)C(=O)O
NH4 RCSB PDB P00929 18.0 Da LogP 0.38 TPSA 36.5 ✓ Ro5 ✓ Clean [NH4+]
NHP RCSB PDB P00929 261.3 Da LogP 2.32 TPSA 83.6 ✓ Ro5 ✓ Clean c1ccc(c(c1)N)SCCCCP(=O)(O)O
P1T RCSB PDB P9WFY1 318.2 Da LogP 0.39 TPSA 149.2 ✓ Ro5 ✓ Clean Cc1c(c(c(cn1)COP(=O)(O)O)CNC(=C)C(=O)O)O
PE8 RCSB PDB H1AFK5 370.4 Da LogP -0.91 TPSA 105.1 ✓ Ro5 ✓ Clean C(COCCOCCOCCOCCOCCOCCOCCO)O
PG5 RCSB PDB P00929 178.2 Da LogP 0.31 TPSA 36.9 ✓ Ro5 ✓ Clean COCCOCCOCCOC
PLS RCSB PDB P00929 336.2 Da LogP -0.76 TPSA 169.4 1 viol. ✓ Clean Cc1c(c(c(cn1)COP(=O)(O)O)CN[C@@H](CO)C(=O)O)O
PZJ RCSB PDB P9WFY1 330.8 Da LogP 0.62 TPSA 60.9 ✓ Ro5 ✓ Clean c1ccc(c(c1)N2CCN(CC2)[C@H]3CS(=O)(=O)C[C@@H]3O)…
PZV RCSB PDB P9WFY1 334.4 Da LogP 1.94 TPSA 66.5 ✓ Ro5 ✓ Clean CNS(=O)(=O)c1ccc2c(c1)CCN2C(=O)c3ccccc3F
V41 RCSB PDB P00929 205.2 Da LogP 0.56 TPSA 117.7 ✓ Ro5 Alert [H]/N=C(/[C@H](C(=O)N)/N=N/c1ccccc1)\N

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.