KpKP13 Protein target profile

2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase

Accession: KP13_31947

Gene: AHE45025.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GN96
Length 253
Pocket druggability (P2Rank · AlphaFold DB model) 0.887
Direct ligand evidence 0 61 total records
Functional annotation 1 EC 4 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
37.662 Lower values reduce human off-target concern.
Human E-value
8.25e-09
Gut microbiome similarity
5.8% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
42.802 Higher values support similarity to known essential genes.
DEG E-value
6.480000000000001e-64 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
97.42 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.887
Structure A0A0H3GN96
Pocket Pocket 1
Druggability (FPocket) 0.491
Structure A0A0H3GN96
Pocket Pocket 8
ColabFold model
P2Rank 0.924 · Pocket 1
FPocket 0.725 · Pocket 2
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 273 / 4744 genomes with a hit
Prevalence 5.8%

Sequence

Primary amino-acid sequence viewer.

MVLNAFDLTGKVAIVTGCDTGLGQGMTLGLAQAGCDIVGINRKIPHDTAAQVLALGRRFHAIQADLSQENDMSGLVDQAVAAMGRVDILVNNAGIIRRHDALTFTESDWDAVIDLNLKAVFFLSQAVARQFIRQGEGGKIINIASMLSFQGGIRVPSYTASKSGVLGLTRLLANEWAGQGINVNAIAPGYMATNNTQALREDEERNQAILERIPAGRWGAPKDLQGPVVFLASSAADYINGYTLAVDGGWLAR

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 4 GO

Subcellular localization

Localization
Cytoplasmic

Enzyme Commission (EC)

1

Gene Ontology (GO)

4
  • GO:0016491 Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
  • GO:0008678 Catalysis of the reaction: 2-deoxy-D-gluconate + NAD+ = 3-dehydro-2-deoxy-D-gluconate + NADH + H+.
  • GO:0051287 Binding to nicotinamide adenine dinucleotide, a coenzyme involved in many redox and biosynthetic reactions; binding may be to either the oxidized form, NAD+, or the reduced form, NADH.
  • GO:0047001 Catalysis of the reaction: NAD+ + 2-dehydro-3-deoxy-D-gluconate = NADH + (4S)-4,6-dihydroxy-2,5-dioxohexanoate.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

27 records
Show feature table
Start End DB Term Name
158 177 PRINTS PR00080 Short-chain dehydrogenase/reductase (SDR) superfamily signature
158 177 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
84 95 PRINTS PR00080 Short-chain dehydrogenase/reductase (SDR) superfamily signature
84 95 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
138 146 PRINTS PR00080 Short-chain dehydrogenase/reductase (SDR) superfamily signature
138 146 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
6 252 CDD cd05347 Ga5DH-like_SDR_c
145 173 ProSitePatterns PS00061 Short-chain dehydrogenases/reductases family signature.
145 173 InterPro IPR020904 Short-chain dehydrogenase/reductase, conserved site
6 252 SUPERFAMILY SSF51735 NAD(P)-binding Rossmann-fold domains
6 252 InterPro IPR036291 NAD(P)-binding domain superfamily
4 250 PANTHER PTHR42760 SHORT-CHAIN DEHYDROGENASES/REDUCTASES FAMILY MEMBER
1 253 FunFam G3DSA:3.40.50.720:FF:000081 2-deoxy-D-gluconate 3-dehydrogenase
20 250 Pfam PF13561 Enoyl-(Acyl carrier protein) reductase
6 253 NCBIfam TIGR01832 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD
6 253 InterPro IPR011286 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase
1 253 Gene3D G3DSA:3.40.50.720 -
158 177 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
132 148 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
132 148 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
179 196 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
179 196 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
12 29 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
12 29 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
84 95 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
214 234 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
214 234 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.887
Likely same site as FPocket 8 5.5 Å 16 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.025
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #8
0.491
Likely same site as P2Rank 1 5.5 Å 16 shared residues 100% of smaller site
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GN96
AlphaFold DB full sequence Viewing
ColabFold KP13_31947
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

61 records
Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 same-protein records
Transferred evidence 11 records from similar proteins
Structural ligands 6 0 loaded crystals
Measured bioactivity 5 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
3HL PDB via homolog 104.1 Da · LogP -0.16 · TPSA 57.5 Open detail RCSB PDB
3HR PDB via homolog Detail RCSB PDB
AAE PDB via homolog Detail RCSB PDB
DXX PDB via homolog Detail RCSB PDB
MLA PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
3HL RCSB PDB Q5KST5 104.1 Da LogP -0.16 TPSA 57.5 ✓ Ro5 ✓ Clean C[C@@H](CC(=O)O)O
3HR RCSB PDB D0VWQ0 104.1 Da LogP -0.16 TPSA 57.5 ✓ Ro5 ✓ Clean C[C@H](CC(=O)O)O
AAE RCSB PDB D0VWQ0 102.1 Da LogP 0.05 TPSA 54.4 ✓ Ro5 ✓ Clean CC(=O)CC(=O)O
DXX RCSB PDB D0VWQ0 118.1 Da LogP -0.21 TPSA 74.6 ✓ Ro5 ✓ Clean CC(C(=O)O)C(=O)O
MLA RCSB PDB D0VWQ0 104.1 Da LogP -0.45 TPSA 74.6 ✓ Ro5 ✓ Clean C(C(=O)O)C(=O)O
TLA RCSB PDB B4EEX4 150.1 Da LogP -2.12 TPSA 115.1 ✓ Ro5 ✓ Clean [C@@H]([C@H](C(=O)O)O)(C(=O)O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.