Target candidate with partial support; inspect missing evidence before prioritizing.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 36.0 Lower values reduce human off-target concern.
- Human E-value
- 9.41e-06
- Gut microbiome similarity
- 3.2% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 0.0 Higher values support similarity to known essential genes.
Structure confidence
- ColabFold pLDDT
- 96.09 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
PDB experimental structureP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MVVHTVKEEKMVKKTVRFGEQAAVPAIGLGTWYMGEHAAQRQQEVAALRAGIDHGLTVIDTAEMYADGGAEEVVGQAIRGLRDRVVLVSKVYPWHAGKAAMHRACENSLRRLQTDYLDMYLLHWRGDIPLQETVEAMEKLVAEGKIRRWGVSNLDTEDMQALWRTADGEHCATNQVLYHLASRGIEYDLLPWCQQHSLPVMAYCPLAQAGRLRDGLFQHSDIINMANARGITVAQLLLAWVIRHPGVLAIPKAASIEHVVQNAAALDIVLSGEELAQLDRLYPPPQRKTRLDMV
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Cytoplasmic
Gene Ontology (GO)
1- GO:0016491 Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 12 | 294 | Gene3D | G3DSA:3.20.20.100 | - |
| 12 | 294 | InterPro | IPR036812 | NADP-dependent oxidoreductase domain superfamily |
| 11 | 294 | PANTHER | PTHR43638 | OXIDOREDUCTASE, ALDO/KETO REDUCTASE FAMILY PROTEIN |
| 13 | 284 | SUPERFAMILY | SSF51430 | NAD(P)-linked oxidoreductase |
| 13 | 284 | InterPro | IPR036812 | NADP-dependent oxidoreductase domain superfamily |
| 137 | 154 | PRINTS | PR00069 | Aldo-keto reductase signature |
| 137 | 154 | InterPro | IPR020471 | Aldo-keto reductase |
| 107 | 125 | PRINTS | PR00069 | Aldo-keto reductase signature |
| 107 | 125 | InterPro | IPR020471 | Aldo-keto reductase |
| 216 | 240 | PRINTS | PR00069 | Aldo-keto reductase signature |
| 216 | 240 | InterPro | IPR020471 | Aldo-keto reductase |
| 27 | 281 | Pfam | PF00248 | Aldo/keto reductase family |
| 27 | 281 | InterPro | IPR023210 | NADP-dependent oxidoreductase domain |
| 14 | 279 | CDD | cd19138 | AKR_YeaE |
| 9 | 128 | PIRSF | PIRSF000097 | AKR |
| 9 | 128 | InterPro | IPR020471 | Aldo-keto reductase |
| 125 | 293 | PIRSF | PIRSF000097 | AKR |
| 125 | 293 | InterPro | IPR020471 | Aldo-keto reductase |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
1 + 1Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural and bioactivity evidence are both available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| ATR RCSB PDB | Q3L181 | 507.2 Da LogP -1.63 TPSA 279.1 | 3 viol. | ✓ Clean |
c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
|
|
| EPR RCSB PDB | Q9X265 | 319.4 Da LogP 2.92 TPSA 57.6 | ✓ Ro5 | Alert |
C/C(=C\c1ccccc1)/C=C2C(=O)N(C(=S)S2)CC(=O)O
|
|
| FLC RCSB PDB | Q9JII6 | 189.1 Da LogP -5.25 TPSA 140.6 | ✓ Ro5 | ✓ Clean |
C(C(=O)[O-])C(CC(=O)[O-])(C(=O)[O-])O
|
|
| TOL RCSB PDB | Q9X265 | 357.4 Da LogP 3.56 TPSA 49.8 | ✓ Ro5 | ✓ Clean |
CN(CC(=O)O)C(=S)c1cccc2c1ccc(c2C(F)(F)F)OC
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
| Ligand | UniProt (homolog) | pchembl | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| CHEMBL269550 ChEMBL | P51635 | 7.55 ~28.2 nM | 261.3 Da LogP 1.40 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCOC(=O)C1=C(O)C(=O)N(Cc2ccccc2)C1
|
| SBI ChEMBL | P51635 | 7.54 ~28.8 nM | 236.2 Da LogP 0.64 TPSA 67.4 | ✓ Ro5 | ✓ Clean |
c1cc2c(cc1F)[C@@]3(CCO2)C(=O)NC(=O)N3
|
| CHEMBL1277476 ChEMBL | P51635 | 6.49 ~323.6 nM | 487.3 Da LogP 4.55 TPSA 83.6 | ✓ Ro5 | ✓ Clean |
Nc1ccc(S(=O)(=O)N(Cc2ccc(Br)cc2F)c2cc(F)c(O)c(F…
|
| CHEMBL33835 ChEMBL | P51635 | 6.31 ~489.8 nM | 342.3 Da LogP 2.82 TPSA 81.4 | ✓ Ro5 | ✓ Clean |
N#CC(C(=O)O)C1C(=O)N(Cc2ccc(F)cc2)c2ccc(F)cc21
|
| CHEMBL30993 ChEMBL | P51635 | 6.16 ~691.8 nM | 338.3 Da LogP 2.99 TPSA 81.4 | ✓ Ro5 | ✓ Clean |
Cc1ccc(CN2C(=O)C(C(C#N)C(=O)O)c3cc(F)ccc32)cc1
|
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC13507152 ZINC | 1.000 | 319.4 Da LogP 2.92 TPSA 57.6 | ✓ Ro5 | Alert |
CC(=C\c1ccccc1)/C=C1/SC(=S)N(CC(=O)O)C1=O
|
| ZINC1533688 ZINC | 1.000 | 319.4 Da LogP 2.92 TPSA 57.6 | ✓ Ro5 | Alert |
CC(/C=C1\SC(=S)N(CC(=O)O)C1=O)=C\c1ccccc1
|
| ZINC1857626813 ZINC | 1.000 | 319.4 Da LogP 2.92 TPSA 57.6 | ✓ Ro5 | Alert |
CC(=Cc1ccccc1)C=C1SC(=S)N(CC(=O)O)C1=O
|
| ZINC2070 ZINC | 1.000 | 236.2 Da LogP 0.64 TPSA 67.4 | ✓ Ro5 | ✓ Clean |
O=C1NC(=O)[C@@]2(CCOc3ccc(F)cc32)N1
|
| ZINC2574862 ZINC | 1.000 | 236.2 Da LogP 0.64 TPSA 67.4 | ✓ Ro5 | ✓ Clean |
O=C1NC(=O)[C@]2(CCOc3ccc(F)cc32)N1
|
| ZINC3780343 ZINC | 1.000 | 357.4 Da LogP 3.56 TPSA 49.8 | ✓ Ro5 | ✓ Clean |
COc1ccc2c(C(=S)N(C)CC(=O)O)cccc2c1C(F)(F)F
|
| ZINC5853925 ZINC | 1.000 | 261.3 Da LogP 1.40 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCOC(=O)C1=C(O)C(=O)N(Cc2ccccc2)C1
|
| ZINC967120 ZINC | 1.000 | 319.4 Da LogP 2.92 TPSA 57.6 | ✓ Ro5 | Alert |
CC(=C/c1ccccc1)/C=C1/SC(=S)N(CC(=O)O)C1=O
|
| ZINC967122 ZINC | 1.000 | 319.4 Da LogP 2.92 TPSA 57.6 | ✓ Ro5 | Alert |
CC(=C/c1ccccc1)/C=C1\SC(=S)N(CC(=O)O)C1=O
|
| ZINC3871401 ZINC | 0.860 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](COP(=O)(O)O)[C@@H](…
|
| ZINC3871402 ZINC | 0.860 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](COP(=O)(O)O)[C@@H]…
|
| ZINC3871403 ZINC | 0.860 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](COP(=O)(O)O)[C@@H](…
|
| ZINC3871404 ZINC | 0.860 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](COP(=O)(O)O)[C@@H]…
|
| ZINC4096223 ZINC | 0.860 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COP(=O)(O)O)[C@@H](…
|
| ZINC12360002 ZINC | 0.842 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC12360703 ZINC | 0.842 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC12503599 ZINC | 0.842 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC16546165 ZINC | 0.842 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@H](CO[P@](=O)(O)OP(=O)(…
|
| ZINC31977053 ZINC | 0.842 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO[P@](=O)(O)OP(=O)…
|
| ZINC4806433 ZINC | 0.842 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC53683898 ZINC | 0.842 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](CO[P@@](=O)(O)OP(=…
|
| ZINC8586019 ZINC | 0.842 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO[P@](=O)(O)OP(=O)…
|
| ZINC8586020 ZINC | 0.842 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](CO[P@@](=O)(O)OP(=…
|
| ZINC8586021 ZINC | 0.842 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC8586022 ZINC | 0.842 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](CO[P@@](=O)(O)OP(=…
|
| ZINC12342798 ZINC | 0.822 | 333.4 Da LogP 3.31 TPSA 57.6 | ✓ Ro5 | Alert |
CC(/C=C1\SC(=S)N(CCC(=O)O)C1=O)=C\c1ccccc1
|
| ZINC4812718 ZINC | 0.822 | 333.4 Da LogP 3.31 TPSA 57.6 | ✓ Ro5 | Alert |
CC(=C\c1ccccc1)/C=C1/SC(=S)N(CCC(=O)O)C1=O
|
| ZINC966742 ZINC | 0.822 | 333.4 Da LogP 3.31 TPSA 57.6 | ✓ Ro5 | Alert |
CC(=C/c1ccccc1)/C=C1/SC(=S)N(CCC(=O)O)C1=O
|
| ZINC966743 ZINC | 0.822 | 333.4 Da LogP 3.31 TPSA 57.6 | ✓ Ro5 | Alert |
CC(=C/c1ccccc1)/C=C1\SC(=S)N(CCC(=O)O)C1=O
|
| ZINC5459256 ZINC | 0.809 | 333.4 Da LogP 3.01 TPSA 46.6 | ✓ Ro5 | Alert |
COC(=O)CN1C(=O)/C(=C/C(C)=C/c2ccccc2)SC1=S
|
| ZINC2999256 ZINC | 0.795 | 384.3 Da LogP 3.25 TPSA 57.6 | ✓ Ro5 | Alert |
O=C(O)CN1C(=O)/C(=C\C(Br)=C\c2ccccc2)SC1=S
|
| ZINC4477968 ZINC | 0.795 | 289.4 Da LogP 3.85 TPSA 20.3 | ✓ Ro5 | Alert |
CCN1C(=O)/C(=C\C(C)=C\c2ccccc2)SC1=S
|
| ZINC27530463 ZINC | 0.792 | 347.5 Da LogP 3.40 TPSA 46.6 | ✓ Ro5 | Alert |
CCOC(=O)CN1C(=O)/C(=C\C(C)=C\c2ccccc2)SC1=S
|
| ZINC4745646 ZINC | 0.792 | 347.5 Da LogP 3.40 TPSA 46.6 | ✓ Ro5 | Alert |
CCOC(=O)CN1C(=O)/C(=C/C(C)=C/c2ccccc2)SC1=S
|
| ZINC13786276 ZINC | 0.791 | 303.3 Da LogP 2.75 TPSA 74.7 | ✓ Ro5 | ✓ Clean |
CC(/C=C1\SC(=O)N(CC(=O)O)C1=O)=C\c1ccccc1
|
| ZINC966749 ZINC | 0.791 | 303.3 Da LogP 2.75 TPSA 74.7 | ✓ Ro5 | ✓ Clean |
CC(=C/c1ccccc1)/C=C1\SC(=O)N(CC(=O)O)C1=O
|
| ZINC12342801 ZINC | 0.787 | 347.5 Da LogP 3.70 TPSA 57.6 | ✓ Ro5 | Alert |
CC(/C=C1\SC(=S)N(CCCC(=O)O)C1=O)=C\c1ccccc1
|
| ZINC1870868 ZINC | 0.787 | 347.5 Da LogP 3.70 TPSA 57.6 | ✓ Ro5 | Alert |
CC(=C/c1ccccc1)/C=C1\SC(=S)N(CCCC(=O)O)C1=O
|
| ZINC2293031015 ZINC | 0.787 | 347.5 Da LogP 3.70 TPSA 57.6 | ✓ Ro5 | Alert |
CC(=Cc1ccccc1)C=C1SC(=S)N(CCCC(=O)O)C1=O
|
| ZINC4837502 ZINC | 0.787 | 347.5 Da LogP 3.70 TPSA 57.6 | ✓ Ro5 | Alert |
CC(=C\c1ccccc1)/C=C1/SC(=S)N(CCCC(=O)O)C1=O
|
| ZINC27530468 ZINC | 0.776 | 372.5 Da LogP 3.46 TPSA 40.6 | ✓ Ro5 | Alert |
CC(=C\c1ccccc1)/C=C1/SC(=S)N(CC(=O)N2CCCC2)C1=O
|
| ZINC4745624 ZINC | 0.776 | 372.5 Da LogP 3.46 TPSA 40.6 | ✓ Ro5 | Alert |
CC(/C=C1\SC(=S)N(CC(=O)N2CCCC2)C1=O)=C\c1ccccc1
|
| ZINC25972840 ZINC | 0.773 | 275.3 Da LogP 1.45 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCOC(=O)C1=C(O)C(=O)N(CCc2ccccc2)C1
|
| ZINC6655268 ZINC | 0.773 | 275.3 Da LogP 1.79 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCOC(=O)C1=C(O)C(=O)N(Cc2ccccc2)CC1
|
| ZINC26466134 ZINC | 0.771 | 375.5 Da LogP 4.48 TPSA 57.6 | ✓ Ro5 | Alert |
CC(=C\c1ccccc1)/C=C1/SC(=S)N(CCCCCC(=O)O)C1=O
|
| ZINC41486 ZINC | 0.767 | 260.3 Da LogP 0.80 TPSA 72.6 | ✓ Ro5 | ✓ Clean |
CCOC(=O)C1=C(N)C(=O)N(Cc2ccccc2)C1
|
| ZINC3861741 ZINC | 0.763 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O…
|
| ZINC4228234 ZINC | 0.763 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COP(=O)(O)O)[C@@H](…
|
| ZINC79671662 ZINC | 0.763 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COP(=O)(O)O)[C@H](O…
|
| ZINC79671663 ZINC | 0.763 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COP(=O)(O)O)[C@H](O…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.