Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 31.707 Lower values reduce human off-target concern.
- Human E-value
- 1.75e-07
- Gut microbiome similarity
- 1.3% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 79.241 Higher values support similarity to known essential genes.
- DEG E-value
- 0.0 Smaller values mean stronger essential-gene similarity.
Localization
- Localization
- Cytoplasmic
Structure confidence
- ColabFold pLDDT
- 93.01 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelThe selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.
Sequence
Sequence
Primary amino-acid sequence viewer.
MKALTYHGPHHVSVDNMPDPALEAADDIILRVTATAICGSDLHLYRGKIPGTHHGDIFGHEFMGEVVEAGSEVTAVRKGDRVVIPFVIACGDCFFCRLQQYAACESTNSGQGATLNRKGISPPAALFGYSDLYGGIPGGQAEYVRVPKANTGPFKVPDTLPDEKVLFLSDILPTAWQAVKNAEVKPGSSVAIFGAGPVGLLCASCARLNGAEQIFIIDHNDYRLDFAQQRYGAIPINFDHHDDPAQWIIDNTPGHRGVDAVIDAVGFEAKGSLTETVLSTLKIEGSSGKALRQCIAAVRRGGIVSVPGVYAGFIHGFMFGDAFDKGLTFRMGQTHVHAWLPDLLALIEQGLLTPEEIVTHHMPLEEAARGYQVFEKREEACRKVILVPGMQPGKATL
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
2- GO:0016491 Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
- GO:0008270 Binding to a zinc ion (Zn).
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 197 | 282 | Pfam | PF00107 | Zinc-binding dehydrogenase |
| 197 | 282 | InterPro | IPR013149 | Alcohol dehydrogenase-like, C-terminal |
| 164 | 349 | SUPERFAMILY | SSF51735 | NAD(P)-binding Rossmann-fold domains |
| 164 | 349 | InterPro | IPR036291 | NAD(P)-binding domain superfamily |
| 1 | 388 | CDD | cd08283 | FDH_like_1 |
| 1 | 196 | SUPERFAMILY | SSF50129 | GroES-like |
| 1 | 196 | InterPro | IPR011032 | GroES-like superfamily |
| 177 | 338 | Gene3D | G3DSA:3.40.50.720 | - |
| 5 | 375 | Gene3D | G3DSA:3.90.180.10 | - |
| 26 | 150 | Pfam | PF08240 | Alcohol dehydrogenase GroES-like domain |
| 26 | 150 | InterPro | IPR013154 | Alcohol dehydrogenase-like, N-terminal |
| 1 | 23 | Pfam | PF13823 | Alcohol dehydrogenase GroES-associated |
| 1 | 23 | InterPro | IPR027399 | Alcohol dehydrogenase GroES-associated |
| 1 | 388 | PANTHER | PTHR42813 | ZINC-TYPE ALCOHOL DEHYDROGENASE-LIKE |
| 59 | 73 | ProSitePatterns | PS00059 | Zinc-containing alcohol dehydrogenases signature. |
| 59 | 73 | InterPro | IPR002328 | Alcohol dehydrogenase, zinc-type, conserved site |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · FPocket
Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GLL4
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_04069
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural and bioactivity evidence are both available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 12H RCSB PDB | P11766 | 216.3 Da LogP 2.96 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
C(CCCCCC(=O)O)CCCCCO
|
|
| AHE RCSB PDB | P11766 | 337.4 Da LogP -2.45 TPSA 179.1 | 1 viol. | ✓ Clean |
C(CC(=O)N[C@@H](CSCO)C(=O)NCC(=O)O)[C@@H](C(=O)…
|
|
| APR RCSB PDB | P11766 | 559.3 Da LogP -3.28 TPSA 291.5 | 3 viol. | ✓ Clean |
c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
|
|
| CAC RCSB PDB | P35630 | 137.0 Da LogP -0.52 TPSA 40.1 | ✓ Ro5 | ✓ Clean |
C[As](=O)(C)[O-]
|
|
| DAO RCSB PDB | P11766 | 200.3 Da LogP 3.99 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCC(=O)O
|
|
| FU2 RCSB PDB | Q46UZ9 | 96.1 Da LogP 1.09 TPSA 30.2 | ✓ Ro5 | ✓ Clean |
c1cc(oc1)C=O
|
|
| ISP RCSB PDB | Q46UZ9 | 140.1 Da LogP 0.50 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CC(C)OP(=O)(O)O
|
|
| N2P RCSB PDB | P11766 | 102.2 Da LogP 0.07 TPSA 52.0 | ✓ Ro5 | ✓ Clean |
C(CCN)CCN
|
|
| SBT RCSB PDB | P14941 | 74.1 Da LogP 0.78 TPSA 20.2 | ✓ Ro5 | ✓ Clean |
CC[C@H](C)O
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
| Ligand | UniProt (homolog) | pchembl | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 022 ChEMBL | P11766 | 7.70 ~20.0 nM | 414.5 Da LogP 3.75 TPSA 103.1 | ✓ Ro5 | Alert |
Cc1cc(ccc1n2c(ccc2c3ccc(cc3)n4ccnc4)CCC(=O)O)C(…
|
| CHEMBL4283157 ChEMBL | P11766 | 7.70 ~20.0 nM | 278.3 Da LogP 3.55 TPSA 55.1 | ✓ Ro5 | ✓ Clean |
Cc1cc(-n2ccnc2)ccc1-c1ccc(C(=O)O)cc1
|
| CHEMBL4290516 ChEMBL | P11766 | 7.66 ~21.9 nM | 288.3 Da LogP 2.72 TPSA 72.3 | ✓ Ro5 | ✓ Clean |
c1cn(-c2ccc(-c3ccc(-c4nn[nH]n4)cc3)cc2)cn1
|
| CHEMBL4282722 ChEMBL | P11766 | 7.54 ~28.8 nM | 282.3 Da LogP 3.38 TPSA 55.1 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(-c2ccc(-n3ccnc3)cc2)c(F)c1
|
| CHEMBL4285078 ChEMBL | P11766 | 7.54 ~28.8 nM | 278.3 Da LogP 3.55 TPSA 55.1 | ✓ Ro5 | ✓ Clean |
Cc1cc(C(=O)O)ccc1-c1ccc(-n2ccnc2)cc1
|
| CHEMBL4292916 ChEMBL | P11766 | 7.52 ~30.2 nM | 298.7 Da LogP 3.89 TPSA 55.1 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(-c2ccc(-n3ccnc3)cc2)c(Cl)c1
|
| CHEMBL4281650 ChEMBL | P11766 | 7.42 ~38.0 nM | 332.3 Da LogP 4.26 TPSA 55.1 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(-c2ccc(-n3ccnc3)cc2)c(C(F)(F)F)c1
|
| CHEMBL4290901 ChEMBL | P11766 | 7.39 ~40.7 nM | 279.3 Da LogP 2.94 TPSA 68.0 | ✓ Ro5 | ✓ Clean |
Cc1cc(-n2ccnc2)cnc1-c1ccc(C(=O)O)cc1
|
| CHEMBL4289534 ChEMBL | P11766 | 7.23 ~58.9 nM | 298.7 Da LogP 3.89 TPSA 55.1 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(-c2ccc(-n3ccnc3)cc2Cl)cc1
|
| CHEMBL4279860 ChEMBL | P11766 | 7.21 ~61.7 nM | 264.3 Da LogP 3.24 TPSA 55.1 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(-c2ccc(-n3ccnc3)cc2)cc1
|
| CHEMBL4280261 ChEMBL | P11766 | 7.05 ~89.1 nM | 299.7 Da LogP 3.29 TPSA 68.0 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(-c2ncc(-n3ccnc3)cc2Cl)cc1
|
| CHEMBL4291013 ChEMBL | P11766 | 6.67 ~213.8 nM | 265.3 Da LogP 2.63 TPSA 68.0 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(-c2ccc(-n3ccnc3)cn2)cc1
|
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC12501520 ZINC | 1.000 | 458.5 Da LogP -0.88 TPSA 123.5 | 1 viol. | ✓ Clean |
OCCOCCOCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC14510370 ZINC | 1.000 | 244.4 Da LogP 3.74 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCCCCCCCCCO
|
| ZINC1529498 ZINC | 1.000 | 200.3 Da LogP 3.99 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCC(=O)O
|
| ZINC1530417 ZINC | 1.000 | 228.4 Da LogP 4.77 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCC(=O)O
|
| ZINC1531061 ZINC | 1.000 | 216.3 Da LogP 2.96 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCCCCCCCO
|
| ZINC1610426 ZINC | 1.000 | 230.3 Da LogP 3.35 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCCCCCCCCO
|
| ZINC1628119 ZINC | 1.000 | 214.3 Da LogP 4.38 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCC(=O)O
|
| ZINC1685531 ZINC | 1.000 | 200.4 Da LogP 2.80 TPSA 52.0 | ✓ Ro5 | ✓ Clean |
NCCCCCCCCCCCCN
|
| ZINC2168567 ZINC | 1.000 | 202.3 Da LogP 2.57 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCCCCCCO
|
| ZINC34273707 ZINC | 1.000 | 256.5 Da LogP 4.37 TPSA 52.0 | ✓ Ro5 | ✓ Clean |
NCCCCCCCCCCCCCCCCN
|
| ZINC3861297 ZINC | 1.000 | 272.4 Da LogP 4.52 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCCCCCCCCCCCO
|
| ZINC3874716 ZINC | 1.000 | 414.5 Da LogP -0.90 TPSA 114.3 | ✓ Ro5 | ✓ Clean |
OCCOCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC4283769 ZINC | 1.000 | 238.3 Da LogP -0.96 TPSA 77.4 | ✓ Ro5 | ✓ Clean |
OCCOCCOCCOCCOCCO
|
| ZINC4284502 ZINC | 1.000 | 258.4 Da LogP 4.13 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCCCCCCCCCCO
|
| ZINC4521548 ZINC | 1.000 | 282.3 Da LogP -0.95 TPSA 86.6 | ✓ Ro5 | ✓ Clean |
OCCOCCOCCOCCOCCOCCO
|
| ZINC5178646 ZINC | 1.000 | 228.4 Da LogP 3.59 TPSA 52.0 | ✓ Ro5 | ✓ Clean |
NCCCCCCCCCCCCCCN
|
| ZINC5178829 ZINC | 1.000 | 326.4 Da LogP -0.93 TPSA 95.8 | ✓ Ro5 | ✓ Clean |
OCCOCCOCCOCCOCCOCCOCCO
|
| ZINC5178830 ZINC | 1.000 | 370.4 Da LogP -0.91 TPSA 105.1 | ✓ Ro5 | ✓ Clean |
OCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC5287109 ZINC | 1.000 | 286.5 Da LogP 4.91 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCCCCCCCCCCCCO
|
| ZINC66156654 ZINC | 1.000 | 414.5 Da LogP 3.75 TPSA 103.1 | ✓ Ro5 | Alert |
Cc1cc(C(N)=O)ccc1-n1c(CCC(=O)O)ccc1-c1ccc(-n2cc…
|
| ZINC4002549 ZINC | 0.969 | 212.2 Da LogP 1.05 TPSA 72.3 | ✓ Ro5 | ✓ Clean |
c1cn(-c2ccc(-c3nn[nH]n3)cc2)cn1
|
| ZINC12360002 ZINC | 0.855 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC12360703 ZINC | 0.855 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC12503599 ZINC | 0.855 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC16546165 ZINC | 0.855 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@H](CO[P@](=O)(O)OP(=O)(…
|
| ZINC31977053 ZINC | 0.855 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO[P@](=O)(O)OP(=O)…
|
| ZINC4806433 ZINC | 0.855 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC53683898 ZINC | 0.855 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](CO[P@@](=O)(O)OP(=…
|
| ZINC8586019 ZINC | 0.855 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO[P@](=O)(O)OP(=O)…
|
| ZINC8586020 ZINC | 0.855 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](CO[P@@](=O)(O)OP(=…
|
| ZINC8586021 ZINC | 0.855 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC8586022 ZINC | 0.855 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](CO[P@@](=O)(O)OP(=…
|
| ZINC138457918 ZINC | 0.850 | 228.3 Da LogP 3.56 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)CCCCC(=O)O
|
| ZINC138458029 ZINC | 0.850 | 228.3 Da LogP 3.56 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCC(=O)CCCCCC(=O)O
|
| ZINC144395054 ZINC | 0.850 | 242.4 Da LogP 3.95 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)CCCCCCCC(=O)O
|
| ZINC14619628 ZINC | 0.850 | 270.4 Da LogP 4.73 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)CCCCCCCCCC(=O)O
|
| ZINC196749828 ZINC | 0.850 | 214.3 Da LogP 3.17 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCC(=O)CCCCC(=O)O
|
| ZINC2113934076 ZINC | 0.850 | 256.4 Da LogP 4.34 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCC(=O)CCCCCCCC(=O)O
|
| ZINC2113934082 ZINC | 0.850 | 256.4 Da LogP 4.34 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)CCCCCCC(=O)O
|
| ZINC2113934083 ZINC | 0.850 | 256.4 Da LogP 4.34 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCC(=O)CCCCC(=O)O
|
| ZINC2243670 ZINC | 0.850 | 228.3 Da LogP 3.56 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)CCCCCCC(=O)O
|
| ZINC2569203 ZINC | 0.850 | 214.3 Da LogP 3.17 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)CCCCCC(=O)O
|
| ZINC4798470 ZINC | 0.850 | 270.4 Da LogP 4.73 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCC(=O)CCCCCCCCC(=O)O
|
| ZINC5973005 ZINC | 0.850 | 242.4 Da LogP 3.95 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCC(=O)CCCCCCC(=O)O
|
| ZINC71418182 ZINC | 0.850 | 270.4 Da LogP 4.73 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCC(=O)CCCCC(=O)O
|
| ZINC79244776 ZINC | 0.850 | 270.4 Da LogP 4.73 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)CCCCCCCC(=O)O
|
| ZINC86037082 ZINC | 0.850 | 270.4 Da LogP 4.73 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCC(=O)CCCCCC(=O)O
|
| ZINC86037089 ZINC | 0.850 | 270.4 Da LogP 4.73 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCC(=O)CCCCCCC(=O)O
|
| ZINC86039283 ZINC | 0.850 | 242.4 Da LogP 3.95 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCC(=O)CCCCC(=O)O
|
| ZINC113465827 ZINC | 0.842 | 286.4 Da LogP 3.70 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCC(=O)CCCCCCCCCCO
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.