KpKP13 Protein target profile

Isocitrate dehydrogenase [NADP]

Accession: KP13_04861

Gene: icd AHE45221.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GVN3
Length 416
Pocket druggability (P2Rank · AlphaFold DB model) 0.733
Direct ligand evidence 0 61 total records
Functional annotation 1 EC 6 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
40.741 Lower values reduce human off-target concern.
Human E-value
4.43e-08
Gut microbiome similarity
11.3% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
97.596 Higher values support similarity to known essential genes.
DEG E-value
0.0 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
97.04 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.733
Structure A0A0H3GVN3
Pocket Pocket 1
Druggability (FPocket) 0.449
Structure A0A0H3GVN3
Pocket Pocket 1
ColabFold model
P2Rank 0.674 · Pocket 1
FPocket 0.083 · Pocket 19
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 537 / 4744 genomes with a hit
Prevalence 11.3%

Sequence

Primary amino-acid sequence viewer.

MESKVVVPAEGQKITLQNGKLNVPHNPIIPFIEGDGIGVDVTPAMLKVVDAAVEKAYKGERKISWMEVYTGEKSTHVYGQDVWLPAETLDLIRDYRVAIKGPLTTPVGGGIRSLNVALRQELDLYVCLRPVRYYQGTPSPVKHPELTDMVIFRENSEDIYAGIEWKADSAEADKVIKFLRDEMGVKKIRFPEHCGIGIKPCSEEGTKRLVRAAIEYAITNDRDSVTLVHKGNIMKFTEGAFKDWGYQLAREEFGGELIDGGPWVKIKNPNTGKEIVVKDVIADAFLQQILLRPAEYDVIACMNLNGDYISDALAAQVGGIGIAPGANIGDECALFEATHGTAPKYAGQDKVNPGSIILSAEMMLRHMQWFEAADLIVKGMEGAIAAKTVTYDFERLMEGAKLLKCSEFGDAIIANM

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 6 GO

Subcellular localization

Localization
Cytoplasmic

Enzyme Commission (EC)

1

Gene Ontology (GO)

6
  • GO:0016616 Catalysis of an oxidation-reduction (redox) reaction in which a CH-OH group acts as a hydrogen or electron donor and reduces NAD+ or NADP.
  • GO:0000287 Binding to a magnesium (Mg) ion.
  • GO:0051287 Binding to nicotinamide adenine dinucleotide, a coenzyme involved in many redox and biosynthetic reactions; binding may be to either the oxidized form, NAD+, or the reduced form, NADH.
  • GO:0006099 A nearly universal metabolic pathway in which the acetyl group of acetyl coenzyme A is effectively oxidized to two CO2 and four pairs of electrons are transferred to coenzymes. The acetyl group combines with oxaloacetate to form citrate, which undergoes successive transformations to isocitrate, 2-oxoglutarate, succinyl-CoA, succinate, fumarate, malate, and oxaloacetate again, thus completing the cycle. In eukaryotes the tricarboxylic acid is confined to the mitochondria. See also glyoxylate cycle.
  • GO:0004450 Catalysis of the reaction: isocitrate + NADP+ = 2-oxoglutarate + CO2 + NADPH.
  • GO:0006097 A modification of the TCA cycle occurring in some plants and microorganisms, in which isocitrate is cleaved to glyoxylate and succinate. Glyoxylate can then react with acetyl-CoA to form malate.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

12 records
Show feature table
Start End DB Term Name
29 412 Pfam PF00180 Isocitrate/isopropylmalate dehydrogenase
29 412 InterPro IPR024084 Isopropylmalate dehydrogenase-like domain
1 416 NCBIfam TIGR00183 isocitrate dehydrogenase (NADP(+))
1 416 InterPro IPR004439 Isocitrate dehydrogenase NADP-dependent, dimeric, prokaryotic
3 416 SUPERFAMILY SSF53659 Isocitrate/Isopropylmalate dehydrogenase-like
303 322 ProSitePatterns PS00470 Isocitrate and isopropylmalate dehydrogenases signature.
303 322 InterPro IPR019818 Isocitrate/isopropylmalate dehydrogenase, conserved site
28 412 SMART SM01329 Iso_dh_2
28 412 InterPro IPR024084 Isopropylmalate dehydrogenase-like domain
1 416 PANTHER PTHR43504 ISOCITRATE DEHYDROGENASE [NADP]
1 416 FunFam G3DSA:3.40.718.10:FF:000005 Isocitrate dehydrogenase [NADP]
1 416 Gene3D G3DSA:3.40.718.10 Isopropylmalate Dehydrogenase

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.733
Likely same site as FPocket 1 3.4 Å 23 shared residues 82% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.417
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.126
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.0
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #1
0.449 Unusual size
Likely same site as P2Rank 1 3.4 Å 23 shared residues 82% of smaller site
Show in viewer
Surrounding area
Residue sets
UniProt: Binding site:104-104
UniProt: Binding site:113-113
UniProt: Binding site:115-115
UniProt: Binding site:119-119
UniProt: Binding site:129-129
UniProt: Binding site:153-153
UniProt: Binding site:307-307
UniProt: Binding site:339-345
UniProt: Binding site:352-352
UniProt: Binding site:391-391
UniProt: Binding site:395-395
UniProt: Site:160-160 Critical for catalysis
UniProt: Site:230-230 Critical for catalysis
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GVN3
AlphaFold DB full sequence Viewing
ColabFold KP13_04861
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

61 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 11 records from similar proteins
Structural ligands 11 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
A2P PDB via homolog 427.2 Da · LogP -1.75 · TPSA 232.6 Open detail RCSB PDB
AKG PDB via homolog Detail RCSB PDB
EE1 PDB via homolog Detail RCSB PDB
ENP PDB via homolog Detail RCSB PDB
FLC PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
A2P RCSB PDB P08200 427.2 Da LogP -1.75 TPSA 232.6 2 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
AKG RCSB PDB P08200 146.1 Da LogP -0.50 TPSA 91.7 ✓ Ro5 ✓ Clean C(CC(=O)O)C(=O)C(=O)O
EE1 RCSB PDB Q5ZXB6 889.5 Da LogP -3.60 TPSA 455.8 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
ENP RCSB PDB Q9YE81 663.3 Da LogP -2.50 TPSA 316.4 3 viol. ✓ Clean c1cn2cnc3c(c2n1)ncn3[C@H]4[C@@H]([C@@H]([C@H](O…
FLC RCSB PDB Q8GAX0 189.1 Da LogP -5.25 TPSA 140.6 ✓ Ro5 ✓ Clean C(C(=O)[O-])C(CC(=O)[O-])(C(=O)[O-])O
ICA RCSB PDB P08200 231.2 Da LogP -1.28 TPSA 121.1 ✓ Ro5 ✓ Clean C([C@@H]([C@H](C(=O)O)O[Ca])C(=O)O)C(=O)O
ICT RCSB PDB P08200 192.1 Da LogP -1.39 TPSA 132.1 ✓ Ro5 ✓ Clean C([C@@H]([C@H](C(=O)O)O)C(=O)O)C(=O)O
NDO RCSB PDB P08200 744.4 Da LogP -3.41 TPSA 361.8 3 viol. ✓ Clean c1cc(c[n+](c1)[C@H]2[C@@H]([C@@H]([C@H](O2)CO[P…
NMN RCSB PDB P08200 335.2 Da LogP -2.20 TPSA 163.4 ✓ Ro5 ✓ Clean c1cc(c[n+](c1)[C@H]2[C@@H]([C@@H]([C@H](O2)COP(…
OXS RCSB PDB P08200 190.1 Da LogP -1.18 TPSA 129.0 ✓ Ro5 ✓ Clean C([C@@H](C(=O)C(=O)O)C(=O)O)C(=O)O
TAP RCSB PDB P08200 759.5 Da LogP -3.00 TPSA 350.6 3 viol. ✓ Clean c1cc(c[n+](c1)[C@H]2[C@@H]([C@@H]([C@H](O2)CO[P…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.