KpKP13 Protein target profile

tRNA-specific 2-thiouridylase mnmA

Accession: KP13_04864

Gene: mnmA AHE45224.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GRM1
Length 368
Pocket druggability (P2Rank · AlphaFold DB model) 0.969
Functional annotation 0 EC 3 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
54.639 Lower values reduce human off-target concern.
Human E-value
1.05e-31
Gut microbiome similarity
19.2% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
93.443 Higher values support similarity to known essential genes.
DEG E-value
0.0 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
92.93 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.969
Structure A0A0H3GRM1
Pocket Pocket 1
Druggability (FPocket) 0.22
Structure A0A0H3GRM1
Pocket Pocket 5
ColabFold model
P2Rank 0.964 · Pocket 1
FPocket 0.54 · Pocket 4
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 912 / 4744 genomes with a hit
Prevalence 19.2%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

Primary amino-acid sequence viewer.

MSESQKKVIVGMSGGVDSSVSAYLLLQQGYKVEGLFMKNWEEDDGEEYCTAAADLADAQAVCDKLGIELHTVNFAAEYWDNVFELFLEEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSQLLRGLDGNKDQSYFLYTLSHEQIAQSLFPVGELEKPQVRKIAEELDLITAKKKDSTGICFIGERKFRDFLGRYLPAQPGKILTVDGEEIGTHQGLMYHTLGQRKGLGIGGTKEGSEDPWYVVDKDVENNILIVAQGHDHPRLMSVGLIAQQLHWVNREPLQGTLRCTVKTRYRQTDIPCTVTALDEDRIEVRFDEPVAAVTPGQSAVFYLGEVCLGGGIIEQRLPLQS

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Subcellular localization

Localization
Cytoplasmic

Gene Ontology (GO)

3
  • GO:0016740 Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
  • GO:0008033 The process in which a pre-tRNA molecule is converted to a mature tRNA, ready for addition of an aminoacyl group.
  • GO:0016783 Catalysis of the transfer of sulfur atoms from one compound (donor) to another (acceptor).

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

21 records
Show feature table
Start End DB Term Name
7 360 CDD cd01998 tRNA_Me_trans
7 360 InterPro IPR004506 tRNA-specific 2-thiouridylase
286 360 Pfam PF20258 Aminomethyltransferase beta-barrel domain
286 360 InterPro IPR046885 tRNA-specific 2-thiouridylase MnmA-like, C-terminal domain
6 360 NCBIfam TIGR00420 tRNA 2-thiouridine(34) synthase MnmA
6 360 InterPro IPR004506 tRNA-specific 2-thiouridylase
6 361 Hamap MF_00144 tRNA-specific 2-thiouridylase MnmA [mnmA].
6 361 InterPro IPR004506 tRNA-specific 2-thiouridylase
1 212 FunFam G3DSA:3.40.50.620:FF:000004 tRNA-specific 2-thiouridylase MnmA
1 211 Gene3D G3DSA:3.40.50.620 HUPs
1 211 InterPro IPR014729 Rossmann-like alpha/beta/alpha sandwich fold
213 280 FunFam G3DSA:2.30.30.280:FF:000001 tRNA-specific 2-thiouridylase MnmA
4 295 SUPERFAMILY SSF52402 Adenine nucleotide alpha hydrolases-like
282 367 FunFam G3DSA:2.40.30.10:FF:000023 tRNA-specific 2-thiouridylase MnmA
6 203 Pfam PF03054 tRNA methyl transferase HUP domain
4 362 PANTHER PTHR11933 TRNA 5-METHYLAMINOMETHYL-2-THIOURIDYLATE -METHYLTRANSFERASE
282 368 Gene3D G3DSA:2.40.30.10 Translation factors
213 281 Gene3D G3DSA:2.30.30.280 -
213 281 InterPro IPR023382 tRNA-specific 2-thiouridylase MnmA-like, central domain superfamily
207 275 Pfam PF20259 tRNA methyl transferase PRC-barrel domain
207 275 InterPro IPR046884 tRNA-specific 2-thiouridylase MnmA-like, central domain

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.969
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.214
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.041
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.035
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #5
0.22
Show in viewer
Surrounding area
Residue sets
UniProt: Active site:102-102 Nucleophile
UniProt: Active site:199-199 Cysteine persulfide intermediate
UniProt: Binding site:11-18
UniProt: Binding site:127-127
UniProt: Binding site:37-37
UniProt: Site:128-128 Interaction with tRNA
UniProt: Site:344-344 Interaction with tRNA
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GRM1
AlphaFold DB full sequence Viewing
ColabFold KP13_04864
ColabFold full sequence Loaded