Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 37.5 Lower values reduce human off-target concern.
- Human E-value
- 7.29e-07
- Gut microbiome similarity
- 2.5% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 86.792 Higher values support similarity to known essential genes.
- DEG E-value
- 0.0 Smaller values mean stronger essential-gene similarity.
Structure confidence
- ColabFold pLDDT
- 96.87 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MDYQLTLNWPDFIERYWQKRPVVLKRGFANFIDPLSPDELAGLAMESEVDSRLVSHQDGKWQVSHGPFESYDHLSENNWSLLVQAVNHWHEPSAALMHPFRALPDWRIDDLMISFSVPGGGVGPHLDQYDVFIIQGTGRRRWRVGEKVPMKQHCPHPDLLQVDPFEAIIDEEMEPGDILYIPPGFPHEGYSLENSLNYSVGYRAPNARELFSGFADYVLQRELGSQRYADPDVPSRDHPADILPTELDRLREMMLGLINQPEHFKQWFGEFITQSRHELDVAPPEPPYQPDEIYDALQQGDTLERLGGLRVLRIDGEVFVNGEKINSPHRPALDALATHLTLRADHFGDALEDPSFLAMLAALVNSGYWFFGD
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Cytoplasmic
Gene Ontology (GO)
2- GO:0016706 Catalysis of the reaction: A + 2-oxoglutarate + O2 = B + succinate + CO2. This is an oxidation-reduction (redox) reaction in which hydrogen or electrons are transferred from 2-oxoglutarate and one other donor, and one atom of oxygen is incorporated into each donor.
- GO:0046872 Binding to a metal ion.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 96 | 210 | Pfam | PF08007 | JmjC domain |
| 96 | 210 | InterPro | IPR003347 | JmjC domain |
| 205 | 372 | Gene3D | G3DSA:3.40.366.30 | 50S ribosomal protein L16 arginine hydroxylase; Chain A, Domain 2 |
| 92 | 215 | SMART | SM00558 | cupin_9 |
| 92 | 215 | InterPro | IPR003347 | JmjC domain |
| 8 | 223 | PANTHER | PTHR13096 | MINA53 MYC INDUCED NUCLEAR ANTIGEN |
| 8 | 223 | InterPro | IPR039994 | JmjC domain-containing |
| 257 | 369 | Pfam | PF20514 | ROXA-like winged helix |
| 257 | 369 | InterPro | IPR046799 | ROXA-like, winged helix |
| 2 | 204 | Gene3D | G3DSA:2.60.120.650 | Cupin |
| 2 | 204 | FunFam | G3DSA:2.60.120.650:FF:000012 | Cupin superfamily protein family |
| 7 | 292 | SUPERFAMILY | SSF51197 | Clavaminate synthase-like |
| 92 | 219 | ProSiteProfiles | PS51184 | JmjC domain profile. |
| 92 | 219 | InterPro | IPR003347 | JmjC domain |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GVM4
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_04871
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| AKG RCSB PDB | P27431 | 146.1 Da LogP -0.50 TPSA 91.7 | ✓ Ro5 | ✓ Clean |
C(CC(=O)O)C(=O)C(=O)O
|
|
| OGA RCSB PDB | D0MK34 | 147.1 Da LogP -1.73 TPSA 103.7 | ✓ Ro5 | ✓ Clean |
C(C(=O)O)NC(=O)C(=O)O
|
|
| PD2 RCSB PDB | Q9H6W3 | 167.1 Da LogP 0.48 TPSA 87.5 | ✓ Ro5 | ✓ Clean |
c1cnc(cc1C(=O)O)C(=O)O
|
|
| SIN RCSB PDB | P27431 | 118.1 Da LogP -0.06 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
C(CC(=O)O)C(=O)O
|
|
| UN9 RCSB PDB | D0MK34 | 280.7 Da LogP 1.41 TPSA 99.5 | ✓ Ro5 | ✓ Clean |
c1ccc2c(c1)c(c(nc2Cl)C(=O)NCC(=O)O)O
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC7670 ZINC | 1.000 | 280.7 Da LogP 1.41 TPSA 99.5 | ✓ Ro5 | ✓ Clean |
O=C(O)CNC(=O)c1nc(Cl)c2ccccc2c1O
|
| ZINC15782053 ZINC | 0.690 | 227.2 Da LogP 2.01 TPSA 67.3 | ✓ Ro5 | ✓ Clean |
O=C(c1ccccc1)c1ccnc(C(=O)O)c1
|
| ZINC331417 ZINC | 0.690 | 227.2 Da LogP 2.01 TPSA 67.3 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccnc(C(=O)c2ccccc2)c1
|
| ZINC38880695 ZINC | 0.680 | 244.2 Da LogP 1.54 TPSA 100.4 | ✓ Ro5 | ✓ Clean |
O=C(O)c1cc(-c2ccnc(C(=O)O)c2)ccn1
|
| ZINC56644 ZINC | 0.680 | 244.2 Da LogP 1.54 TPSA 100.4 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccnc(-c2cc(C(=O)O)ccn2)c1
|
| ZINC35570360 ZINC | 0.667 | 223.6 Da LogP 2.29 TPSA 70.4 | ✓ Ro5 | ✓ Clean |
O=C(O)c1nc(Cl)c2ccccc2c1O
|
| ZINC166201325 ZINC | 0.656 | 223.2 Da LogP 1.74 TPSA 76.5 | ✓ Ro5 | ✓ Clean |
CC(C)(C)OC(=O)c1ccnc(C(=O)O)c1
|
| ZINC26439009 ZINC | 0.655 | 243.2 Da LogP 2.15 TPSA 87.5 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(-c2ccnc(C(=O)O)c2)cc1
|
| ZINC3593496 ZINC | 0.652 | 206.2 Da LogP -1.16 TPSA 121.1 | ✓ Ro5 | ✓ Clean |
COC(=O)C[C@@](O)(CC(=O)O)C(=O)O
|
| ZINC3593497 ZINC | 0.652 | 206.2 Da LogP -1.16 TPSA 121.1 | ✓ Ro5 | ✓ Clean |
COC(=O)C[C@](O)(CC(=O)O)C(=O)O
|
| ZINC14686440 ZINC | 0.625 | 436.4 Da LogP -2.64 TPSA 247.9 | 1 viol. | ✓ Clean |
O=C(O)C[C@](O)(CC(=O)NCCCCNC(=O)C[C@@](O)(CC(=O…
|
| ZINC14686442 ZINC | 0.625 | 436.4 Da LogP -2.64 TPSA 247.9 | 1 viol. | ✓ Clean |
O=C(O)C[C@@](O)(CC(=O)NCCCCNC(=O)C[C@](O)(CC(=O…
|
| ZINC14686444 ZINC | 0.625 | 436.4 Da LogP -2.64 TPSA 247.9 | 1 viol. | ✓ Clean |
O=C(O)C[C@@](O)(CC(=O)NCCCCNC(=O)C[C@@](O)(CC(=…
|
| ZINC390821980 ZINC | 0.625 | 223.2 Da LogP 1.74 TPSA 76.5 | ✓ Ro5 | ✓ Clean |
CC(C)(C)OC(=O)c1cc(C(=O)O)ccn1
|
| ZINC151256 ZINC | 0.607 | 202.0 Da LogP 1.54 TPSA 50.2 | ✓ Ro5 | ✓ Clean |
O=C(O)c1cc(Br)ccn1
|
| ZINC333016 ZINC | 0.607 | 249.0 Da LogP 1.38 TPSA 50.2 | ✓ Ro5 | ✓ Clean |
O=C(O)c1cc(I)ccn1
|
| ZINC3866429 ZINC | 0.607 | 202.0 Da LogP 1.54 TPSA 50.2 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccnc(Br)c1
|
| ZINC4352682 ZINC | 0.607 | 249.0 Da LogP 1.38 TPSA 50.2 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccnc(I)c1
|
| ZINC38342145 ZINC | 0.600 | 237.6 Da LogP 2.38 TPSA 59.4 | ✓ Ro5 | ✓ Clean |
COC(=O)c1nc(Cl)c2ccccc2c1O
|
| ZINC35654093 ZINC | 0.586 | 365.3 Da LogP 2.30 TPSA 150.6 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccnc(-c2cc(C(=O)O)cc(-c3cc(C(=O)O)ccn3)…
|
| ZINC47214440 ZINC | 0.586 | 200.2 Da LogP 1.84 TPSA 63.1 | ✓ Ro5 | ✓ Clean |
O=C(O)c1cc(-c2ccncc2)ccn1
|
| ZINC47214422 ZINC | 0.581 | 200.2 Da LogP 1.84 TPSA 63.1 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccnc(-c2ccncc2)c1
|
| ZINC13398039 ZINC | 0.577 | 234.2 Da LogP -0.38 TPSA 121.1 | ✓ Ro5 | ✓ Clean |
CC(C)OC(=O)C[C@](O)(CC(=O)O)C(=O)O
|
| ZINC2528012 ZINC | 0.577 | 234.2 Da LogP -0.38 TPSA 121.1 | ✓ Ro5 | ✓ Clean |
CC(C)OC(=O)C[C@@](O)(CC(=O)O)C(=O)O
|
| ZINC168888549 ZINC | 0.571 | 284.3 Da LogP -0.35 TPSA 104.6 | ✓ Ro5 | ✓ Clean |
O=C(O)c1cc(C(=O)N2CCS(=O)(=O)CC2)ccn1
|
| ZINC2598993 ZINC | 0.567 | 203.2 Da LogP 0.03 TPSA 104.6 | ✓ Ro5 | ✓ Clean |
O=C(O)c1cc(S(=O)(=O)O)ccn1
|
| ZINC146315135 ZINC | 0.560 | 204.2 Da LogP 0.86 TPSA 94.8 | ✓ Ro5 | ✓ Clean |
CCCCC[C@@](O)(CC(=O)O)C(=O)O
|
| ZINC146315336 ZINC | 0.560 | 204.2 Da LogP 0.86 TPSA 94.8 | ✓ Ro5 | ✓ Clean |
CCCCC[C@](O)(CC(=O)O)C(=O)O
|
| ZINC124644877 ZINC | 0.553 | 264.3 Da LogP 0.81 TPSA 99.5 | ✓ Ro5 | ✓ Clean |
O=C(N[C@@H]1CCCC[C@@H]1O)c1ccnc(C(=O)O)c1
|
| ZINC124645116 ZINC | 0.553 | 264.3 Da LogP 0.81 TPSA 99.5 | ✓ Ro5 | ✓ Clean |
O=C(N[C@H]1CCCC[C@@H]1O)c1ccnc(C(=O)O)c1
|
| ZINC124645281 ZINC | 0.553 | 264.3 Da LogP 0.81 TPSA 99.5 | ✓ Ro5 | ✓ Clean |
O=C(N[C@@H]1CCCC[C@H]1O)c1ccnc(C(=O)O)c1
|
| ZINC124645494 ZINC | 0.553 | 264.3 Da LogP 0.81 TPSA 99.5 | ✓ Ro5 | ✓ Clean |
O=C(N[C@H]1CCCC[C@H]1O)c1ccnc(C(=O)O)c1
|
| ZINC136976573 ZINC | 0.553 | 250.3 Da LogP 0.69 TPSA 88.5 | ✓ Ro5 | ✓ Clean |
O=C(NC1CCOCC1)c1ccnc(C(=O)O)c1
|
| ZINC1708388 ZINC | 0.548 | 287.3 Da LogP 3.54 TPSA 47.0 | ✓ Ro5 | ✓ Clean |
O=C(c1ccccc1)c1ccnc(C(=O)c2ccccc2)c1
|
| ZINC20357742 ZINC | 0.548 | 200.2 Da LogP 1.84 TPSA 63.1 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccnc(-c2ccccn2)c1
|
| ZINC2598999 ZINC | 0.548 | 203.2 Da LogP 0.03 TPSA 104.6 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccnc(S(=O)(=O)O)c1
|
| ZINC38283909 ZINC | 0.548 | 214.2 Da LogP 2.15 TPSA 63.1 | ✓ Ro5 | ✓ Clean |
Cc1ccnc(-c2cc(C(=O)O)ccn2)c1
|
| ZINC65347060 ZINC | 0.548 | 213.2 Da LogP 2.76 TPSA 50.2 | ✓ Ro5 | ✓ Clean |
Cc1ccc(-c2ccnc(C(=O)O)c2)cc1
|
| ZINC74941936 ZINC | 0.548 | 304.3 Da LogP 1.33 TPSA 118.8 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccnc(OCCOc2cc(C(=O)O)ccn2)c1
|
| ZINC98213921 ZINC | 0.545 | 207.1 Da LogP 1.68 TPSA 59.4 | ✓ Ro5 | ✓ Clean |
O=C(O)c1cc(OC(F)(F)F)ccn1
|
| ZINC263424469 ZINC | 0.541 | 220.2 Da LogP 0.92 TPSA 79.3 | ✓ Ro5 | ✓ Clean |
C[C@@H]1C[C@H]1NC(=O)c1cc(C(=O)O)ccn1
|
| ZINC263424470 ZINC | 0.541 | 220.2 Da LogP 0.92 TPSA 79.3 | ✓ Ro5 | ✓ Clean |
C[C@H]1C[C@H]1NC(=O)c1cc(C(=O)O)ccn1
|
| ZINC263424471 ZINC | 0.541 | 220.2 Da LogP 0.92 TPSA 79.3 | ✓ Ro5 | ✓ Clean |
C[C@@H]1C[C@@H]1NC(=O)c1cc(C(=O)O)ccn1
|
| ZINC263424472 ZINC | 0.541 | 220.2 Da LogP 0.92 TPSA 79.3 | ✓ Ro5 | ✓ Clean |
C[C@H]1C[C@@H]1NC(=O)c1cc(C(=O)O)ccn1
|
| ZINC71257465 ZINC | 0.540 | 352.3 Da LogP 2.86 TPSA 108.8 | ✓ Ro5 | ✓ Clean |
Cc1nc(C(=O)NCC(=O)O)c(O)c2ccc(Oc3ccccc3)cc12
|
| ZINC1595538 ZINC | 0.538 | 211.1 Da LogP 0.18 TPSA 124.8 | ✓ Ro5 | ✓ Clean |
O=C(O)c1cc(C(=O)O)nc(C(=O)O)c1
|
| ZINC306145916 ZINC | 0.531 | 241.1 Da LogP 2.43 TPSA 50.2 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccnc(C(F)(F)C(F)(F)F)c1
|
| ZINC42684404 ZINC | 0.531 | 201.2 Da LogP 0.18 TPSA 84.3 | ✓ Ro5 | ✓ Clean |
CS(=O)(=O)c1cc(C(=O)O)ccn1
|
| ZINC65348611 ZINC | 0.531 | 268.1 Da LogP 3.75 TPSA 50.2 | ✓ Ro5 | ✓ Clean |
O=C(O)c1cc(-c2ccc(Cl)c(Cl)c2)ccn1
|
| ZINC79006721 ZINC | 0.531 | 202.2 Da LogP -0.57 TPSA 110.4 | ✓ Ro5 | ✓ Clean |
NS(=O)(=O)c1cc(C(=O)O)ccn1
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.