Strong target candidate with converging metabolic, structural and chemical evidence.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 3.3% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 0.0 Higher values support similarity to known essential genes.
Structure confidence
- ColabFold pLDDT
- 86.86 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MTTPLKKIVIVGGGAGGLELATQLGRKLGRHKKAKITLVDRNHSHLWKPLLHEVATGSLDEGVDALSYLAHARNHGFQFQLGSVVDINREGKTITLGELRNEKGELLVAERKLPYDTLVMALGSTSNDFNTPGVKENCIFLDNPHQARRFHQEMLNLFLKYSANLGANGKVNIAIVGGGATGVELSAELHNAVKQLHSYGYKGLTNEALNVTLVEAGERILPALPPRISGAAHNELTKLGVRVLTQTMVTSADAGGLHTKDGEYIEADLMVWAAGIKAPDFMKEIGGLETNRINQLVVEPTLQTTRDADIFAIGDCASCARPEGGFVPPRAQAAHQMATCALNNILAQMKGKPLKAYTYKDHGSLVSLSNYSTVGSLMGNLMRGSMMVEGRIARFVYISLYRMHQIALHGYFKTGLMMLVGRINRIIRPRLKLH
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- CytoplasmicMembrane
Gene Ontology (GO)
3- GO:0016491 Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
- GO:0003955 Catalysis of the reaction: NAD(P)H + H+ + a quinone = NAD(P)+ + a quinol.
- GO:0019646 A process in which a series of electron carriers operate together to transfer electrons from donors such as NADH and FADH2 to oxygen to generate a transmembrane electrochemical gradient.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 5 | 413 | Gene3D | G3DSA:3.50.50.100 | - |
| 6 | 338 | Pfam | PF07992 | Pyridine nucleotide-disulphide oxidoreductase |
| 6 | 338 | InterPro | IPR023753 | FAD/NAD(P)-binding domain |
| 168 | 352 | SUPERFAMILY | SSF51905 | FAD/NAD(P)-binding domain |
| 168 | 352 | InterPro | IPR036188 | FAD/NAD(P)-binding domain superfamily |
| 6 | 403 | PANTHER | PTHR42913 | APOPTOSIS-INDUCING FACTOR 1 |
| 6 | 224 | SUPERFAMILY | SSF51905 | FAD/NAD(P)-binding domain |
| 6 | 224 | InterPro | IPR036188 | FAD/NAD(P)-binding domain superfamily |
| 172 | 197 | PRINTS | PR00411 | Pyridine nucleotide disulphide reductase class-I signature |
| 310 | 317 | PRINTS | PR00411 | Pyridine nucleotide disulphide reductase class-I signature |
| 7 | 29 | PRINTS | PR00411 | Pyridine nucleotide disulphide reductase class-I signature |
| 5 | 413 | FunFam | G3DSA:3.50.50.100:FF:000001 | NADH dehydrogenase |
| 115 | 133 | PRINTS | PR00368 | FAD-dependent pyridine nucleotide reductase signature |
| 8 | 27 | PRINTS | PR00368 | FAD-dependent pyridine nucleotide reductase signature |
| 172 | 190 | PRINTS | PR00368 | FAD-dependent pyridine nucleotide reductase signature |
| 295 | 317 | PRINTS | PR00368 | FAD-dependent pyridine nucleotide reductase signature |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GMU6
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_04904
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural and bioactivity evidence are both available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 4W0 RCSB PDB | Q8I302 | 427.4 Da LogP 6.13 TPSA 42.1 | 1 viol. | ✓ Clean |
CC1=C(Nc2cccc(c2C1=O)F)c3ccc(cc3)Cc4ccc(cc4)OC(…
|
|
| CXS RCSB PDB | Q8I302 | 221.3 Da LogP 1.19 TPSA 66.4 | ✓ Ro5 | ✓ Clean |
C1CCC(CC1)NCCCS(=O)(=O)O
|
|
| HQO RCSB PDB | F5L3B8 | 259.3 Da LogP 3.69 TPSA 47.2 | ✓ Ro5 | Alert |
CCCCCCCc1cc(c2ccccc2[n+]1[O-])O
|
|
| MLI RCSB PDB | Q2FZV7 | 102.0 Da LogP -3.12 TPSA 80.3 | ✓ Ro5 | ✓ Clean |
C(C(=O)[O-])C(=O)[O-]
|
|
| TRT RCSB PDB | Q8I302 | 352.5 Da LogP 4.46 TPSA 36.9 | ✓ Ro5 | ✓ Clean |
CC(C)(C)CC(C)(C)c1ccc(cc1)OCCOCCOCCOC
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
| Ligand | UniProt (homolog) | pchembl | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| CHEMBL5186518 ChEMBL | P95160 | 7.92 ~12.0 nM | 412.5 Da LogP 3.78 TPSA 42.0 | ✓ Ro5 | ✓ Clean |
CC(C)[C@H]1CO[C@]23CCN(Cc4ccc(OC(F)(F)F)cc4)C[C…
|
| CHEMBL5201484 ChEMBL | P95160 | 7.92 ~12.0 nM | 396.5 Da LogP 3.90 TPSA 32.8 | ✓ Ro5 | ✓ Clean |
CC(C)[C@H]1CO[C@]23CCN(Cc4ccc(C(F)(F)F)cc4)C[C@…
|
| CHEMBL5171834 ChEMBL | P95160 | 7.55 ~28.2 nM | 362.9 Da LogP 3.54 TPSA 32.8 | ✓ Ro5 | ✓ Clean |
CC(C)[C@H]1CO[C@]23CCN(Cc4ccc(Cl)cc4)C[C@H]2CCC…
|
| CHEMBL5202255 ChEMBL | P95160 | 7.50 ~31.6 nM | 397.4 Da LogP 3.30 TPSA 45.7 | ✓ Ro5 | ✓ Clean |
CC(C)[C@H]1CO[C@]23CCN(Cc4ccc(C(F)(F)F)nc4)C[C@…
|
| CHEMBL5206556 ChEMBL | P95160 | 6.70 ~199.5 nM | 358.5 Da LogP 2.89 TPSA 42.0 | ✓ Ro5 | ✓ Clean |
COc1ccc(CN2CC[C@]34OC[C@H](C(C)C)N3C(=O)CC[C@@H…
|
| CHEMBL5182198 ChEMBL | P95160 | 6.47 ~338.8 nM | 328.5 Da LogP 2.88 TPSA 32.8 | ✓ Ro5 | ✓ Clean |
CC(C)[C@H]1CO[C@]23CCN(Cc4ccccc4)C[C@H]2CCC(=O)…
|
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC1529909 ZINC | 1.000 | 259.3 Da LogP 3.69 TPSA 47.2 | ✓ Ro5 | Alert |
CCCCCCCc1cc(O)c2ccccc2[n+]1[O-]
|
| ZINC2004372 ZINC | 1.000 | 221.3 Da LogP 1.19 TPSA 66.4 | ✓ Ro5 | ✓ Clean |
O=S(=O)(O)CCCNC1CCCCC1
|
| ZINC38364153 ZINC | 0.926 | 235.3 Da LogP 1.58 TPSA 66.4 | ✓ Ro5 | ✓ Clean |
O=S(=O)(O)CCCCNC1CCCCC1
|
| ZINC1710230 ZINC | 0.786 | 207.3 Da LogP 0.80 TPSA 66.4 | ✓ Ro5 | ✓ Clean |
O=S(=O)(O)CCNC1CCCCC1
|
| ZINC2030966 ZINC | 0.750 | 294.4 Da LogP 3.79 TPSA 38.7 | ✓ Ro5 | ✓ Clean |
CC(C)(C)CC(C)(C)c1ccc(OCCOCCO)cc1
|
| ZINC1592053 ZINC | 0.711 | 321.5 Da LogP 4.36 TPSA 21.7 | ✓ Ro5 | ✓ Clean |
CN(C)CCOCCOc1ccc(C(C)(C)CC(C)(C)C)cc1
|
| ZINC167273021 ZINC | 0.692 | 308.4 Da LogP 3.88 TPSA 55.8 | ✓ Ro5 | ✓ Clean |
CC(C)(C)CC(C)(C)c1ccc(OCCOCC(=O)O)cc1
|
| ZINC25756964 ZINC | 0.645 | 402.5 Da LogP 1.80 TPSA 73.8 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOc1ccc(OCCOCCOCCOC)cc1
|
| ZINC1532311 ZINC | 0.639 | 250.4 Da LogP 3.77 TPSA 29.5 | ✓ Ro5 | ✓ Clean |
CC(C)(C)CC(C)(C)c1ccc(OCCO)cc1
|
| ZINC1857731210 ZINC | 0.631 | 368.4 Da LogP 3.26 TPSA 32.8 | ✓ Ro5 | ✓ Clean |
CC(C)[C@@H]1CO[C@@]23CCN(Cc4ccc(C(F)(F)F)cc4)[C…
|
| ZINC5188799 ZINC | 0.630 | 280.5 Da LogP 4.39 TPSA 24.1 | ✓ Ro5 | ✓ Clean |
C(CCCNC1CCCCC1)CCNC1CCCCC1
|
| ZINC4353076 ZINC | 0.628 | 352.5 Da LogP 4.42 TPSA 68.3 | ✓ Ro5 | ✓ Clean |
CC(C)(C)CC(C)(C)c1ccc(OCCOCCSC(=N)N)cc1
|
| ZINC1688152 ZINC | 0.622 | 380.5 Da LogP 3.96 TPSA 55.8 | ✓ Ro5 | ✓ Clean |
CC(C)(C)CC(C)(C)c1ccc(OCCOCC[N+](C)(C)CC(=O)O)c…
|
| ZINC35650209 ZINC | 0.605 | 278.4 Da LogP 4.55 TPSA 29.5 | ✓ Ro5 | ✓ Clean |
CC(C)(C)CC(C)(C)c1ccc(OCCCCO)cc1
|
| ZINC226069334 ZINC | 0.605 | 366.6 Da LogP 3.86 TPSA 38.7 | ✓ Ro5 | ✓ Clean |
CC(C)(C)CC(C)(C)c1ccc(OCCOC[C@@H](O)C[N+](C)(C)…
|
| ZINC226069348 ZINC | 0.605 | 366.6 Da LogP 3.86 TPSA 38.7 | ✓ Ro5 | ✓ Clean |
CC(C)(C)CC(C)(C)c1ccc(OCCOC[C@H](O)C[N+](C)(C)C…
|
| ZINC32011214 ZINC | 0.600 | 363.5 Da LogP 4.13 TPSA 30.9 | ✓ Ro5 | ✓ Clean |
CC(C)(C)CC(C)(C)c1ccc(OCCOCCN2CCOCC2)cc1
|
| ZINC685938638 ZINC | 0.600 | 253.3 Da LogP 3.64 TPSA 32.9 | ✓ Ro5 | ✓ Clean |
Cc1c(-c2ccccc2)[nH]c2cccc(F)c2c1=O
|
| ZINC1693494 ZINC | 0.588 | 220.4 Da LogP 4.41 TPSA 9.2 | ✓ Ro5 | ✓ Clean |
COc1ccc(C(C)(C)CC(C)(C)C)cc1
|
| ZINC220528199 ZINC | 0.588 | 478.6 Da LogP 3.47 TPSA 73.8 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOc1ccc(-c2ccc(OCCOCCOCCOC)cc2)cc1
|
| ZINC2984023 ZINC | 0.583 | 344.5 Da LogP 4.47 TPSA 36.9 | ✓ Ro5 | ✓ Clean |
COc1ccc(OCCOCCOc2ccc(C(C)(C)C)cc2)cc1
|
| ZINC34211424 ZINC | 0.571 | 319.2 Da LogP 2.51 TPSA 36.9 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOc1ccc(Br)cc1
|
| ZINC95982959 ZINC | 0.571 | 240.3 Da LogP 2.13 TPSA 36.9 | ✓ Ro5 | ✓ Clean |
CCOc1ccc(OCCOCCOC)cc1
|
| ZINC64844 ZINC | 0.564 | 264.4 Da LogP 3.86 TPSA 46.5 | ✓ Ro5 | ✓ Clean |
CC(C)(C)CC(C)(C)c1ccc(OCC(=O)O)cc1
|
| ZINC126169091 ZINC | 0.556 | 256.3 Da LogP 1.45 TPSA 57.2 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOc1ccc(O)cc1
|
| ZINC14630111 ZINC | 0.556 | 211.3 Da LogP 1.31 TPSA 53.7 | ✓ Ro5 | Alert |
COCCOCCOc1ccc(N)cc1
|
| ZINC90556265 ZINC | 0.556 | 255.3 Da LogP 1.33 TPSA 62.9 | ✓ Ro5 | Alert |
COCCOCCOCCOc1ccc(N)cc1
|
| ZINC226069639 ZINC | 0.553 | 365.6 Da LogP 4.15 TPSA 50.7 | ✓ Ro5 | ✓ Clean |
CC(C)NC[C@@H](O)COCCOc1ccc(C(C)(C)CC(C)(C)C)cc1
|
| ZINC226069650 ZINC | 0.553 | 365.6 Da LogP 4.15 TPSA 50.7 | ✓ Ro5 | ✓ Clean |
CC(C)NC[C@H](O)COCCOc1ccc(C(C)(C)CC(C)(C)C)cc1
|
| ZINC142979416 ZINC | 0.553 | 284.3 Da LogP 1.44 TPSA 74.2 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOc1ccc(C(=O)O)cc1
|
| ZINC4775495 ZINC | 0.553 | 246.4 Da LogP 4.97 TPSA 9.2 | ✓ Ro5 | ✓ Clean |
C=CCOc1ccc(C(C)(C)CC(C)(C)C)cc1
|
| ZINC1857713799 ZINC | 0.549 | 396.4 Da LogP 2.83 TPSA 49.9 | ✓ Ro5 | ✓ Clean |
CC(C)[C@@H]1CO[C@@]23CCN(C(=O)Cc4ccc(C(F)(F)F)c…
|
| ZINC1698725 ZINC | 0.541 | 314.4 Da LogP 4.46 TPSA 27.7 | ✓ Ro5 | ✓ Clean |
CC(C)(C)c1ccc(OCCOCCOc2ccccc2)cc1
|
| ZINC1857731857 ZINC | 0.539 | 383.4 Da LogP 2.30 TPSA 62.7 | ✓ Ro5 | ✓ Clean |
CC(C)[C@@H]1CO[C@@]23CCN(C(=O)c4ccc(C(F)(F)F)nc…
|
| ZINC1857722404 ZINC | 0.537 | 362.9 Da LogP 2.47 TPSA 49.9 | ✓ Ro5 | ✓ Clean |
CC(C)[C@@H]1CO[C@@]23CCN(C(=O)Cc4ccc(Cl)cc4)[C@…
|
| ZINC4200484 ZINC | 0.537 | 262.4 Da LogP 4.18 TPSA 21.8 | ✓ Ro5 | ✓ Clean |
CC(C)(C)CC(C)(C)c1ccc(OC[C@@H]2CO2)cc1
|
| ZINC4200485 ZINC | 0.537 | 262.4 Da LogP 4.18 TPSA 21.8 | ✓ Ro5 | ✓ Clean |
CC(C)(C)CC(C)(C)c1ccc(OC[C@H]2CO2)cc1
|
| ZINC16889914 ZINC | 0.535 | 308.5 Da LogP 4.41 TPSA 59.1 | ✓ Ro5 | ✓ Clean |
CC(C)(C)CC(C)(C)c1ccc(OCCSC(=N)N)cc1
|
| ZINC2509149 ZINC | 0.531 | 211.4 Da LogP 4.27 TPSA 12.0 | ✓ Ro5 | ✓ Clean |
CCCCCCCCNC1CCCCC1
|
| ZINC130127586 ZINC | 0.529 | 260.4 Da LogP 1.38 TPSA 58.2 | ✓ Ro5 | ✓ Clean |
O=S(=O)(NCCNC1CCCCCC1)C1CC1
|
| ZINC1857724257 ZINC | 0.529 | 356.5 Da LogP 3.54 TPSA 32.8 | ✓ Ro5 | ✓ Clean |
CC(C)[C@@H]1CO[C@@]23CCN(Cc4ccc(C(C)(C)C)cc4)[C…
|
| ZINC1857717617 ZINC | 0.526 | 384.4 Da LogP 3.14 TPSA 42.0 | ✓ Ro5 | ✓ Clean |
CC(C)[C@@H]1CO[C@@]23CCN(Cc4cccc(OC(F)(F)F)c4)[…
|
| ZINC70027652 ZINC | 0.526 | 226.3 Da LogP 1.22 TPSA 47.9 | ✓ Ro5 | ✓ Clean |
COCCOCCOc1ccc(CO)cc1
|
| ZINC126188107 ZINC | 0.525 | 319.4 Da LogP 0.39 TPSA 97.1 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOc1ccc(S(N)(=O)=O)cc1
|
| ZINC1857726557 ZINC | 0.522 | 376.9 Da LogP 2.86 TPSA 49.9 | ✓ Ro5 | ✓ Clean |
CC(C)[C@@H]1CO[C@@]23CCN(C(=O)CCc4ccc(Cl)cc4)[C…
|
| ZINC1857734870 ZINC | 0.522 | 352.8 Da LogP 3.04 TPSA 32.8 | ✓ Ro5 | ✓ Clean |
CC(C)[C@@H]1CO[C@@]23CCN(Cc4ccc(F)c(Cl)c4)[C@@H…
|
| ZINC19367005 ZINC | 0.519 | 224.4 Da LogP 2.83 TPSA 24.1 | ✓ Ro5 | ✓ Clean |
C1CCC(NCCNC2CCCCC2)CC1
|
| ZINC19432075 ZINC | 0.514 | 231.1 Da LogP 2.47 TPSA 18.5 | ✓ Ro5 | ✓ Clean |
COCCOc1ccc(Br)cc1
|
| ZINC42226887 ZINC | 0.514 | 278.1 Da LogP 2.32 TPSA 18.5 | ✓ Ro5 | ✓ Clean |
COCCOc1ccc(I)cc1
|
| ZINC1600788 ZINC | 0.514 | 234.4 Da LogP 4.55 TPSA 9.2 | ✓ Ro5 | ✓ Clean |
COCc1ccc(C(C)(C)CC(C)(C)C)cc1
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.