KpKP13 Protein target profile

PTS system glucose-specific EIICB component

Accession: KP13_04911

Gene: AHE45271.1 ptsG 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GRI2
Length 477
Pocket druggability (P2Rank · AlphaFold DB model) 0.865
Functional annotation 1 EC 9 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
2.6% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
49.513 Higher values support similarity to known essential genes.
DEG E-value
1.88e-152 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
91.33 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.865
Structure A0A0H3GRI2
Pocket Pocket 1
Druggability (FPocket) 0.928
Structure A0A0H3GRI2
Pocket Pocket 2
ColabFold model
P2Rank 0.94 · Pocket 1
FPocket 0.372 · Pocket 23
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 125 / 4744 genomes with a hit
Prevalence 2.6%

Sequence

Primary amino-acid sequence viewer.

MFKNAFANLQKVGKSLMLPVSVLPIAGILLGVGSANFSWLPAVVSHVMAEAGGSVFANMPLIFAIGVALGFTNNDGVSALAAVVAYGIMVKTMAVVAPLVLHLPADEIAAKHLADTGVLGGIISGAIAAYMFNRFYRIKLPEYLGFFAGKRFVPIISGLAAIFTGVILSFIWPPIGSAIQTFSQWAAYQNPVVAFGIYGFIERCLVPFGLHHIWNVPFQMQIGEYTNAAGQVFHGDIPRYMAGDPTAGKLSGGFLFKMYGLPAAAIAIWHSAKPENRAKVGGIMISAALTSFLTGITEPIEFSFMFVAPILYVIHAILAGLAFPICILLGMRDGTSFSHGLIDFIVLSGNSSKLWLFPIVGICYAIVYYVIFRVLIKALDLKTPGREDTTEESKAGATSEMAPALVAAFGGKENITNLDACITRLRVSVADVAKVDQAGLKKLGAAGVVVAGSGVQAIFGTKSDNLKTEMDEYIRNS

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 9 GO

Subcellular localization

Localization
CytoplasmicMembrane

Enzyme Commission (EC)

1

Gene Ontology (GO)

9
  • GO:1904659 The process in which D-glucose is transported across a membrane.
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0005355 OBSOLETE. Enables the transfer of the hexose monosaccharide glucose from one side of a membrane to the other.
  • GO:0009401 The uptake and phosphorylation of specific carbohydrates from the extracellular environment; uptake and phosphorylation are coupled, making the PTS a link between the uptake and metabolism of sugars; phosphoenolpyruvate is the original phosphate donor; phosphoenolpyruvate passes the phosphate via a signal transduction pathway, to enzyme 1 (E1), which in turn passes it on to the histidine protein, HPr; the next step in the system involves sugar-specific membrane-bound complex, enzyme 2 (EII), which transports the sugar into the cell; it includes the sugar permease, which catalyzes the transport reactions; EII is usually divided into three different domains, EIIA, EIIB, and EIIC.
  • GO:0008982 Catalysis of the PEP-dependent, phosphoryl transfer-driven transport of substances across a membrane. The transport happens by catalysis of the reaction: protein N-phosphohistidine + sugar(out) = protein histidine + sugar phosphate(in). This differs from primary and secondary active transport in that the solute is modified during transport.
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
  • GO:0055056 Enables the transfer of the D-enantiomer of the hexose monosaccharide glucose from one side of a membrane to the other.
  • GO:0016301 Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
  • GO:0090564 Catalysis of the PEP-dependent, phosphoryl transfer-driven transport of substances across a membrane. The transport happens by catalysis of the reaction: protein S-phosphocysteine + glucose(out) = protein cysteine + glucose phosphate(in). This differs from primary and secondary active transport in that the solute is modified during transport.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

53 records
Show feature table
Start End DB Term Name
154 176 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
377 477 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
298 303 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
21 43 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
250 272 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
72 76 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
3 388 ProSiteProfiles PS51103 PTS_EIIC type-1 domain profile.
3 388 InterPro IPR013013 Phosphotransferase system, EIIC component, type 1
40 50 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
282 304 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
397 475 FunFam G3DSA:3.30.1360.60:FF:000001 PTS system glucose-specific IIBC component PtsG
13 320 Pfam PF02378 Phosphotransferase system, EIIC
13 320 InterPro IPR003352 Phosphotransferase system, EIIC
332 353 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
354 376 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
2 476 PANTHER PTHR30009 CYTOCHROME C-TYPE SYNTHESIS PROTEIN AND PTS TRANSMEMBRANE COMPONENT
309 331 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
116 133 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
133 151 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
113 132 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
1 15 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
51 71 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
79 101 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
354 376 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
191 213 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
52 331 NCBIfam TIGR00852 maltose/glucose-specific PTS transporter subunit IIC
52 331 InterPro IPR004719 Phosphotransferase system, maltose/glucose-specific subfamily IIC component
414 431 ProSitePatterns PS01035 PTS EIIB domains cysteine phosphorylation site signature.
414 431 InterPro IPR018113 Phosphotransferase system EIIB, cysteine phosphorylation site
304 331 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
399 474 CDD cd00212 PTS_IIB_glc
399 474 InterPro IPR018113 Phosphotransferase system EIIB, cysteine phosphorylation site
53 72 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
396 477 Gene3D G3DSA:3.30.1360.60 Glucose permease domain IIB
396 477 InterPro IPR036878 Glucose permease domain IIB
2 475 NCBIfam TIGR02002 glucose-specific PTS transporter subunit IIBC
2 475 InterPro IPR011299 PTS system glucose-specific IIBC component
273 277 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
405 436 Pfam PF00367 phosphotransferase system, EIIB
405 436 InterPro IPR018113 Phosphotransferase system EIIB, cysteine phosphorylation site
152 172 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
399 477 ProSiteProfiles PS51098 PTS_EIIB type-1 domain profile.
399 477 InterPro IPR001996 Phosphotransferase system, IIB component, type 1
77 101 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
278 297 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
16 39 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
173 253 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
102 112 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
378 460 NCBIfam TIGR00826 glucose PTS transporter subunit EIIB
378 460 InterPro IPR001996 Phosphotransferase system, IIB component, type 1
401 474 SUPERFAMILY SSF55604 Glucose permease domain IIB
401 474 InterPro IPR036878 Glucose permease domain IIB
254 272 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.865
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.188
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.173
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.157
Likely same site as FPocket 2 3.6 Å 10 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.078
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #2
0.928 Unusual size
Likely same site as P2Rank 4 3.6 Å 10 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 2 FPocket #12
0.325
Show in viewer
Surrounding area
Residue sets
UniProt: Active site:421-421 Phosphocysteine intermediate; for EIIB activity
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GRI2
AlphaFold DB full sequence Viewing
ColabFold KP13_04911
ColabFold full sequence Loaded

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.