KpKP13 Protein target profile

Glyoxylate/hydroxypyruvate reductase A bifunctional protein

Accession: KP13_04955

Gene: AHE45317.1 ghrA 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GLA5
Length 312
Pocket druggability (P2Rank · AlphaFold DB model) 0.941
Direct ligand evidence 0 55 total records
Functional annotation 2 EC 6 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
37.5 Lower values reduce human off-target concern.
Human E-value
2.3e-06
Gut microbiome similarity
2.2% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
75.641 Higher values support similarity to known essential genes.
DEG E-value
2.3300000000000002e-177 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
97.85 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.941
Structure A0A0H3GLA5
Pocket Pocket 1
Druggability (FPocket) 0.663
Structure A0A0H3GLA5
Pocket Pocket 14
ColabFold model
P2Rank 0.936 · Pocket 1
FPocket 0.644 · Pocket 14
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 104 / 4744 genomes with a hit
Prevalence 2.2%

Sequence

Primary amino-acid sequence viewer.

MEIIFYHPTFDTQYWICELEKQLPGARVREWKAGDNRPADYALVWHPPVEMLQGRALKAVFALGAGVDSILSKLRDHPDMLPLSIPLFRLEDTGMGRQMQEYAVSQVLHWFRRFDDYQALKLASRWQPLPEYRADEFTVGIMGAGVLGAKVAESLQPWGFPLRVWSRSRKSWPQVQSFAGQAELGEFLQGTRVLINLLPNTAETAGIINQTLLAQLPDESYVLNLARGVHVVEEDLLAALNSGKLKGAMLDVFSREPLPQESPLWAHPRVAMTPHVAAVTRPMEAITYIAETISRLERGEPVSGQVDRQRGY

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

2 EC 6 GO

Subcellular localization

Localization
Cytoplasmic

Enzyme Commission (EC)

2

Gene Ontology (GO)

6
  • GO:0016618 Catalysis of the reaction: (R)-glycerate + NAD(P)+ = 3-hydroxypyruvate + NAD(P)H + H+.
  • GO:0051287 Binding to nicotinamide adenine dinucleotide, a coenzyme involved in many redox and biosynthetic reactions; binding may be to either the oxidized form, NAD+, or the reduced form, NADH.
  • GO:0030267 Catalysis of the reaction: glycolate + NADP+ = glyoxylate + NADPH + H+.
  • GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
  • GO:0008465 Catalysis of the reaction: (R)-glycerate + NAD+ = 3-hydroxypyruvate + NADH + H+.
  • GO:0120509 Catalysis of the reaction: (R)-glycerate + NADP+ = 3-hydroxypyruvate + NADPH + H+.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

11 records
Show feature table
Start End DB Term Name
94 278 Gene3D G3DSA:3.40.50.720 -
98 278 SUPERFAMILY SSF51735 NAD(P)-binding Rossmann-fold domains
98 278 InterPro IPR036291 NAD(P)-binding domain superfamily
14 307 Gene3D G3DSA:3.40.50.720 -
55 312 PANTHER PTHR43333 2-HACID_DH_C DOMAIN-CONTAINING PROTEIN
1 310 CDD cd12164 GDH_like_2
105 277 Pfam PF02826 D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
105 277 InterPro IPR006140 D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding domain
1 312 Hamap MF_01666 Glyoxylate/hydroxypyruvate reductase A [ghrA].
1 312 InterPro IPR023514 Glyoxylate/hydroxypyruvate reductase A, Enterobacterales
94 278 FunFam G3DSA:3.40.50.720:FF:000110 Glyoxylate/hydroxypyruvate reductase A

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.941
Likely same site as FPocket 21 3.3 Å 39 shared residues 91% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.091
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.011
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #14
0.663
Show in viewer
Surrounding area
Pocket 2 FPocket #21
0.448 Unusual size
Likely same site as P2Rank 1 3.3 Å 39 shared residues 91% of smaller site
Show in viewer
Surrounding area
Residue sets
UniProt: Active site:227-227
UniProt: Active site:275-275 Proton donor
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GLA5
AlphaFold DB full sequence Viewing
ColabFold KP13_04955
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

55 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 5 records from similar proteins
Structural ligands 5 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
7N5 PDB via homolog 130.1 Da · LogP 0.83 · TPSA 54.4 Open detail RCSB PDB
GLV PDB via homolog Detail RCSB PDB
OXD PDB via homolog Detail RCSB PDB
PE4 PDB via homolog Detail RCSB PDB
TLA PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
7N5 RCSB PDB Q2VEQ7 130.1 Da LogP 0.83 TPSA 54.4 ✓ Ro5 ✓ Clean CCCCC(=O)C(=O)O
GLV RCSB PDB P75913 74.0 Da LogP -0.73 TPSA 54.4 ✓ Ro5 ✓ Clean C(=O)C(=O)O
OXD RCSB PDB Q2KDT2 90.0 Da LogP -0.84 TPSA 74.6 ✓ Ro5 ✓ Clean C(=O)(C(=O)O)O
PE4 RCSB PDB B5XVG7 354.4 Da LogP 0.11 TPSA 84.8 ✓ Ro5 ✓ Clean CCOCCOCCOCCOCCOCCOCCOCCO
TLA RCSB PDB Q2KDT2 150.1 Da LogP -2.12 TPSA 115.1 ✓ Ro5 ✓ Clean [C@@H]([C@H](C(=O)O)O)(C(=O)O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.