KpKP13 Protein target profile

Inner membrane protein

Accession: KP13_03886

Gene: AHE45367.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GQU6
Length 219
Pocket druggability (P2Rank · AlphaFold DB model) 0.771
Direct ligand evidence 0 14 total records
Functional annotation 0 EC 3 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
30.263 Lower values reduce human off-target concern.
Human E-value
3.14e-06
Gut microbiome similarity
2.6% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
53.182 Higher values support similarity to known essential genes.
DEG E-value
2.65e-67 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
88.04 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.771
Structure A0A0H3GQU6
Pocket Pocket 1
Druggability (FPocket) 0.704
Structure A0A0H3GQU6
Pocket Pocket 2
ColabFold model
P2Rank 0.818 · Pocket 1
FPocket 0.679 · Pocket 2
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 121 / 4744 genomes with a hit
Prevalence 2.6%

Sequence

Primary amino-acid sequence viewer.

MDRIITSSRDRSSLLSTHKVLRNTYFLLSLTLAFSAITATASTVLMLPSPGLILTLVGMYGLMFLTYKTANKPTGIISAFAFTGFLGYILGPMLNAYLSAGMGDLIGLALGGTALVFFCCSAYVLTTRKDMSFLGGMLMAGVVVVLIGMVANLFLQLPALHLAISAVFILISSGAILFETSNIIRGGETNYIRATVSLYVSLYNIFVSLLSILGFASRD

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Subcellular localization

Localization
CytoplasmicMembrane

Gene Ontology (GO)

3
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0043066 Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

29 records
Show feature table
Start End DB Term Name
194 216 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
45 67 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
1 19 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
217 219 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
74 96 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
127 132 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
132 154 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
133 154 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
42 46 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
196 216 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
159 181 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
21 40 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
185 195 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
19 213 Pfam PF01027 Inhibitor of apoptosis-promoting Bax1
19 213 InterPro IPR006214 Bax inhibitor 1-related
68 78 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
100 104 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
106 125 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
17 217 CDD cd10433 YccA_like
87 117 ProSitePatterns PS01243 Bax inhibitor-1 family signature.
87 117 InterPro IPR006213 Bax inhibitor 1, conserved site
105 126 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
47 67 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
79 99 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
155 159 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
18 215 PANTHER PTHR23291 BAX INHIBITOR-RELATED
18 215 InterPro IPR006214 Bax inhibitor 1-related
20 41 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
160 184 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.771
Likely same site as FPocket 2 1.8 Å 15 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.504
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.193
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.05
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.048
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #2
0.704
Likely same site as P2Rank 1 1.8 Å 15 shared residues 100% of smaller site
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GQU6
AlphaFold DB full sequence Viewing
ColabFold KP13_03886
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

14 records
Chemistry signal

Bioactivity evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 5 records from similar proteins
Structural ligands 0 0 loaded crystals
Measured bioactivity 5 direct and transferred ChEMBL records
Proposed compounds 9 similarity-based ZINC candidates
Best available ligand signal
CHEMBL4282466 ChEMBL via homolog 546.7 Da · LogP 4.40 · TPSA 124.3 Open detail ChEMBL
CHEMBL5590853 ChEMBL via homolog Detail ChEMBL
CHEMBL5591567 ChEMBL via homolog Detail ChEMBL
CHEMBL5591937 ChEMBL via homolog Detail ChEMBL
CHEMBL5593128 ChEMBL via homolog Detail ChEMBL

Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).

Show only:
Ligand UniProt (homolog) pchembl MW · LogP · TPSA Lipinski PAINS SMILES
CHEMBL4282466 ChEMBL P55061 546.7 Da LogP 4.40 TPSA 124.3 1 viol. ✓ Clean CCCCCCCCCCCC(=O)O[C@@]12C[C@@H](C)[C@]34C=C(C)[…
CHEMBL5590853 ChEMBL P55061 709.9 Da LogP 6.10 TPSA 167.1 2 viol. ✓ Clean C#CCCC1(CCNC(=O)O[C@H]2C(C)=C[C@]34C(=O)[C@@H](…
CHEMBL5591567 ChEMBL P55061 631.9 Da LogP 5.55 TPSA 142.4 2 viol. ✓ Clean CCCCCCCCCCCC(=O)O[C@@]12C[C@@H](C)[C@]34C=C(C)[…
CHEMBL5591937 ChEMBL P55061 845.0 Da LogP 7.95 TPSA 222.7 3 viol. ✓ Clean CCCCCCCCCCCC(=O)O[C@@]12C[C@@H](C)[C@]34C=C(C)[…
CHEMBL5593128 ChEMBL P55061 668.8 Da LogP 6.41 TPSA 130.4 2 viol. ✓ Clean CCCCCCCCCCCC(=O)O[C@@]12C[C@@H](C)[C@]34C=C(C)[…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.