Protein target profile

KP13_03863

ABC transporter ATP-binding protein uup

Genome: KpKP13 Gene: uup AHE45390.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GR34
Length 635
Pocket druggability 0.056
Direct ligand evidence 0 55 total records
Functional annotation 1 EC 6 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
36.458 Lower values reduce human off-target concern.
Human E-value
1e-14
Gut microbiome similarity
3.4% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
64.743 Higher values support similarity to known essential genes.
DEG E-value
0.0 Smaller values mean stronger essential-gene similarity.

Localization

Localization
Cytoplasmic

Structure confidence

ColabFold pLDDT
84.66 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.056
Structure A0A0H3GR34
Pocket Pocket 21
P2Rank 0.655
Structure A0A0H3GR34
Pocket Pocket 1
ColabFold model
FPocket 0.419 · Pocket 2
P2Rank 0.623 · Pocket 1
Core conservation Accessory gene
Roary core
CoreCruncher accessory
Gut microbiome 159 / 4744 genomes with a hit
Prevalence 3.4%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

Primary amino-acid sequence viewer.

MSLISMHGAWLSFSDAPLLDNAELHIEDNERVCLVGRNGAGKSTLMKILNREQGLDDGRIIYEQDLIVARLQQDPPRNVAGTVYDFVAEGIAEQAAYLKAYHDVSHQVMTDPSDKNLNELARLQEQLDNLGLWQLDSRINEVIEQLGLDANAQLASLSGGWLRKAALGRALVSGPRVLLLDEPTNHLDIETIDWLEGFLKTFKGTIIFISHDRSFIRNMATRIVDLDRGKLVTYPGNYDQYLLDKEEALRVEELQNAEFDRKLAQEEVWIRQGIKARRTRNEGRVRALKAMRRERGERREVMGSAKMQVEEASRSGKIVFEMENVNYQVDGKVLVKDFSAQIQRGDKIALIGPNGCGKTTLLKLMLGQLQADSGRIHVGTKLEVAYFDQHRAELDPDKTVMDNLAEGKQEVMVNGKPRHVLGYLQDFLFHPKRAMTPVRALSGGERNRLLLARLFLKPSNLLILDEPTNDLDVETLELLEELIDGYQGTVMLVSHDRQFVDNTVTECWIFEGGGRIGQYVGGYHDARGQQAQSLAQKQTVVKKTTEVAQPKAETVKRGGNKLSYNLQRELEQLPQKLEALEAELQTLQDQVADPDFFGQPHDRTQQVLAQLAEAEQALEAAFERWEYLEGLKNGA

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 6 GO

Enzyme Commission (EC)

1

Gene Ontology (GO)

6
  • GO:0005524 Binding to ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
  • GO:0016887 Catalysis of the reaction: ATP + H2O = ADP + H+ phosphate. ATP hydrolysis is used in some reactions as an energy source, for example to catalyze a reaction or drive transport against a concentration gradient.
  • GO:0006281 The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
  • GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
  • GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
  • GO:0043022 Binding to a ribosome.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

40 records
Show feature table
Start End DB Term Name
4 230 CDD cd03221 ABCF_EF-3
224 293 Pfam PF12848 ABC transporter
224 293 InterPro IPR032781 ABC-transporter extension domain
311 501 SUPERFAMILY SSF52540 P-loop containing nucleoside triphosphate hydrolases
311 501 InterPro IPR027417 P-loop containing nucleoside triphosphate hydrolase
1 279 FunFam G3DSA:3.40.50.300:FF:000011 Putative ABC transporter ATP-binding component
561 629 Pfam PF16326 ABC transporter C-terminal domain
561 629 InterPro IPR032524 ABC transporter Uup, C-terminal
1 630 Hamap MF_00848 ATP-binding protein Uup [uup].
1 630 InterPro IPR043686 ATP-binding protein Uup
281 551 Gene3D G3DSA:3.40.50.300 -
281 551 InterPro IPR027417 P-loop containing nucleoside triphosphate hydrolase
1 629 PANTHER PTHR42855 ABC TRANSPORTER ATP-BINDING SUBUNIT
320 546 ProSiteProfiles PS50893 ATP-binding cassette, ABC transporter-type domain profile.
320 546 InterPro IPR003439 ABC transporter-like, ATP-binding domain
336 469 Pfam PF00005 ABC transporter
336 469 InterPro IPR003439 ABC transporter-like, ATP-binding domain
321 514 CDD cd03221 ABCF_EF-3
28 230 SMART SM00382 AAA_5
28 230 InterPro IPR003593 AAA+ ATPase domain
344 514 SMART SM00382 AAA_5
344 514 InterPro IPR003593 AAA+ ATPase domain
551 635 FunFam G3DSA:1.10.287.380:FF:000003 ABC transporter ATP-binding protein uup
19 185 Pfam PF00005 ABC transporter
19 185 InterPro IPR003439 ABC transporter-like, ATP-binding domain
157 171 ProSitePatterns PS00211 ABC transporters family signature.
157 171 InterPro IPR017871 ABC transporter-like, conserved site
1 253 ProSiteProfiles PS50893 ATP-binding cassette, ABC transporter-type domain profile.
1 253 InterPro IPR003439 ABC transporter-like, ATP-binding domain
441 455 ProSitePatterns PS00211 ABC transporters family signature.
441 455 InterPro IPR017871 ABC transporter-like, conserved site
552 635 Gene3D G3DSA:1.10.287.380 -
552 635 InterPro IPR037118 Valyl-tRNA synthetase, tRNA-binding arm superfamily
10 279 Gene3D G3DSA:3.40.50.300 -
10 279 InterPro IPR027417 P-loop containing nucleoside triphosphate hydrolase
9 239 SUPERFAMILY SSF52540 P-loop containing nucleoside triphosphate hydrolases
9 239 InterPro IPR027417 P-loop containing nucleoside triphosphate hydrolase
604 624 Coils Coil Coil
281 550 FunFam G3DSA:3.40.50.300:FF:000309 ABC transporter ATP-binding protein
563 590 Coils Coil Coil

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Site 1 P2Rank #1
0.655
Show in viewer
Surrounding area
Site 2 P2Rank #2
0.426
Show in viewer
Surrounding area
Site 3 P2Rank #3
0.401
Show in viewer
Surrounding area
Site 4 P2Rank #4
0.073
Show in viewer
Surrounding area
Site 5 P2Rank #5
0.045
Show in viewer
Surrounding area
Residue sets
UniProt: Binding site:352-359
UniProt: Binding site:36-43
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GR34
AlphaFold DB full sequence Viewing
ColabFold KP13_03863
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

55 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 5 records from similar proteins
Structural ligands 5 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
AGS PDB via homolog 523.2 Da · LogP -1.51 · TPSA 262.1 Open detail RCSB PDB
ANP PDB via homolog Detail RCSB PDB
AT4 PDB via homolog Detail RCSB PDB
NH4 PDB via homolog Detail RCSB PDB
POP PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
AGS RCSB PDB D0VWX4 523.2 Da LogP -1.51 TPSA 262.1 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
ANP RCSB PDB D0VWX4 506.2 Da LogP -2.06 TPSA 281.9 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
AT4 RCSB PDB D0VWX4 443.3 Da LogP -0.81 TPSA 212.4 2 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
NH4 RCSB PDB Q9YGA6 18.0 Da LogP 0.38 TPSA 36.5 ✓ Ro5 ✓ Clean [NH4+]
POP RCSB PDB O57933 176.0 Da LogP -2.08 TPSA 129.9 ✓ Ro5 ✓ Clean O[P@@](=O)([O-])O[P@@](=O)(O)[O-]

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.