Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 1.8% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 76.364 Higher values support similarity to known essential genes.
- DEG E-value
- 1.82e-154 Smaller values mean stronger essential-gene similarity.
Structure confidence
- ColabFold pLDDT
- 94.77 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MKRMMRIVLLALLLTGCAGEKGIIDRDGYQLDTRHPAQAAYPRIKVLVIHYTADNFDVSLATLTDKEVSSHYLIPEQPPRYQHKPRIWQLVPEEDLAWHAGVSYWRGSTRINDTSIGIELENRGWQKTAGVKSFTPFHPEQIAALIPLARDIIARYHIAPQNVVAHADIAPQRKDDPGPLFPWQQLAQQGIGAWPDEQRVAFYLNGRPASEPVDPEIVLDLLSRYGYQVTPEMTPAQKKRVIIAFQMHFRPQRWDGVADAQTEAIAEALLEKYGQG
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Unknown
Enzyme Commission (EC)
1Gene Ontology (GO)
5- GO:0009253 The chemical reactions and pathways resulting in the breakdown of peptidoglycans, any of a class of glycoconjugates found in bacterial cell walls and consisting of long glycan strands of alternating residues of beta-(1,4) linked N-acetylglucosamine and N-acetylmuramic acid, cross-linked by short peptides.
- GO:0008745 Catalysis of the hydrolysis of the link between N-acetylmuramoyl residues and L-amino acid residues in certain bacterial cell-wall glycopeptides.
- GO:0019867 The external membrane of Gram-negative bacteria or certain organelles such as mitochondria and chloroplasts; freely permeable to most ions and metabolites.
- GO:0071555 A process that results in the assembly, arrangement of constituent parts, or disassembly of the cell wall, the rigid or semi-rigid envelope lying outside the cell membrane of plant, fungal and most prokaryotic cells, maintaining their shape and protecting them from osmotic lysis.
- GO:0009254 The continual breakdown and regeneration of peptidoglycan required to maintain the bacterial cell wall. Peptidoglycans consist of long glycan strands of alternating residues of beta-(1,4) linked N-acetylglucosamine and N-acetylmuramic acid, cross-linked by short peptides.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 7 | 14 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. |
| 1 | 19 | SignalP_EUK | SignalP-noTM | SignalP-noTM |
| 42 | 179 | Pfam | PF01510 | N-acetylmuramoyl-L-alanine amidase |
| 42 | 179 | InterPro | IPR002502 | N-acetylmuramoyl-L-alanine amidase domain |
| 43 | 180 | CDD | cd06583 | PGRP |
| 43 | 180 | InterPro | IPR002502 | N-acetylmuramoyl-L-alanine amidase domain |
| 36 | 269 | PANTHER | PTHR30417 | N-ACETYLMURAMOYL-L-ALANINE AMIDASE AMID |
| 32 | 178 | SMART | SM00644 | ami_2 |
| 32 | 178 | InterPro | IPR002502 | N-acetylmuramoyl-L-alanine amidase domain |
| 42 | 192 | FunFam | G3DSA:3.40.80.10:FF:000003 | N-acetylmuramoyl-L-alanine amidase |
| 43 | 192 | Gene3D | G3DSA:3.40.80.10 | - |
| 43 | 192 | InterPro | IPR036505 | N-acetylmuramoyl-L-alanine amidase/PGRP domain superfamily |
| 1 | 20 | SignalP_GRAM_NEGATIVE | SignalP-noTM | SignalP-noTM |
| 1 | 6 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. |
| 16 | 42 | Gene3D | G3DSA:6.20.370.150 | - |
| 23 | 194 | SUPERFAMILY | SSF55846 | N-acetylmuramoyl-L-alanine amidase-like |
| 23 | 194 | InterPro | IPR036505 | N-acetylmuramoyl-L-alanine amidase/PGRP domain superfamily |
| 198 | 273 | SUPERFAMILY | SSF47090 | PGBD-like |
| 198 | 273 | InterPro | IPR036365 | PGBD-like superfamily |
| 1 | 19 | Phobius | SIGNAL_PEPTIDE | Signal peptide region |
| 20 | 276 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 193 | 276 | Gene3D | G3DSA:1.10.101.10 | - |
| 193 | 276 | InterPro | IPR036366 | PGBD superfamily |
| 15 | 19 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. |
| 1 | 17 | ProSiteProfiles | PS51257 | Prokaryotic membrane lipoprotein lipid attachment site profile. |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GKW4
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_04238
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC15722130 ZINC | 0.745 | 488.5 Da LogP -2.61 TPSA 243.0 | 1 viol. | ✓ Clean |
C[C@H](N)C(=O)N[C@H](CCC(=O)N[C@@H](CCCCN)C(=O)…
|
| ZINC255987061 ZINC | 0.745 | 488.5 Da LogP -2.61 TPSA 243.0 | 1 viol. | ✓ Clean |
C[C@H](N)C(=O)N[C@H](CCC(=O)N[C@H](CCCCN)C(=O)N…
|
| ZINC255987062 ZINC | 0.745 | 488.5 Da LogP -2.61 TPSA 243.0 | 1 viol. | ✓ Clean |
C[C@H](N)C(=O)N[C@H](CCC(=O)N[C@H](CCCCN)C(=O)N…
|
| ZINC255987063 ZINC | 0.745 | 488.5 Da LogP -2.61 TPSA 243.0 | 1 viol. | ✓ Clean |
C[C@H](N)C(=O)N[C@H](CCC(=O)N[C@H](CCCCN)C(=O)N…
|
| ZINC255987064 ZINC | 0.745 | 488.5 Da LogP -2.61 TPSA 243.0 | 1 viol. | ✓ Clean |
C[C@H](N)C(=O)N[C@H](CCC(=O)N[C@H](CCCCN)C(=O)N…
|
| ZINC13514803 ZINC | 0.667 | 347.3 Da LogP -1.88 TPSA 196.1 | 1 viol. | ✓ Clean |
C[C@H](NC(=O)CC[C@H](NC(=O)CC[C@H](N)C(=O)O)C(=…
|
| ZINC13514809 ZINC | 0.565 | 404.4 Da LogP -1.77 TPSA 222.1 | 1 viol. | ✓ Clean |
NCCCC[C@H](NC(=O)CC[C@H](NC(=O)CC[C@H](N)C(=O)O…
|
| ZINC2567650 ZINC | 0.565 | 288.3 Da LogP -2.33 TPSA 164.6 | ✓ Ro5 | ✓ Clean |
C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C…
|
| ZINC2242980 ZINC | 0.558 | 218.2 Da LogP -1.23 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
C[C@H](N)C(=O)N[C@@H](CCC(=O)O)C(=O)O
|
| ZINC2560662 ZINC | 0.558 | 218.2 Da LogP -1.23 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
C[C@@H](N)C(=O)N[C@H](CCC(=O)O)C(=O)O
|
| ZINC15261541 ZINC | 0.556 | 261.3 Da LogP -1.51 TPSA 155.7 | ✓ Ro5 | ✓ Clean |
NCCC[C@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)O
|
| ZINC1529737 ZINC | 0.548 | 218.2 Da LogP -1.23 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
C[C@@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)O
|
| ZINC2384790 ZINC | 0.548 | 218.2 Da LogP -1.23 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
C[C@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)O
|
| ZINC2560745 ZINC | 0.548 | 218.2 Da LogP -1.23 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
C[C@@H](NC(=O)CC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC2560989 ZINC | 0.548 | 218.2 Da LogP -1.23 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
C[C@H](NC(=O)CC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC1575564 ZINC | 0.545 | 202.3 Da LogP 0.09 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CCCC[C@H](NC(=O)[C@@H](C)N)C(=O)O
|
| ZINC1575565 ZINC | 0.545 | 202.3 Da LogP 0.09 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CCCC[C@@H](NC(=O)[C@@H](C)N)C(=O)O
|
| ZINC1575566 ZINC | 0.545 | 202.3 Da LogP 0.09 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CCCC[C@H](NC(=O)[C@H](C)N)C(=O)O
|
| ZINC1575567 ZINC | 0.545 | 202.3 Da LogP 0.09 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CCCC[C@@H](NC(=O)[C@H](C)N)C(=O)O
|
| ZINC2242694 ZINC | 0.545 | 276.2 Da LogP -1.39 TPSA 167.0 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCC(=O)N[C@@H](CCC(=O)O)C(=O)O)C(=O)O
|
| ZINC2504612 ZINC | 0.545 | 217.2 Da LogP -1.83 TPSA 135.5 | ✓ Ro5 | ✓ Clean |
C[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)O
|
| ZINC2547582 ZINC | 0.545 | 276.2 Da LogP -1.39 TPSA 167.0 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCC(=O)N[C@H](CCC(=O)O)C(=O)O)C(=O)O
|
| ZINC2560934 ZINC | 0.545 | 217.2 Da LogP -1.83 TPSA 135.5 | ✓ Ro5 | ✓ Clean |
C[C@H](N)C(=O)N[C@H](CCC(N)=O)C(=O)O
|
| ZINC2560982 ZINC | 0.545 | 217.2 Da LogP -1.83 TPSA 135.5 | ✓ Ro5 | ✓ Clean |
C[C@@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)O
|
| ZINC3204007 ZINC | 0.545 | 203.2 Da LogP -1.36 TPSA 118.4 | ✓ Ro5 | ✓ Clean |
C[C@H](N)C(=O)N[C@@H](CCCN)C(=O)O
|
| ZINC4096970 ZINC | 0.545 | 405.4 Da LogP -2.04 TPSA 233.4 | 1 viol. | ✓ Clean |
N[C@@H](CCC(=O)N[C@@H](CCC(=O)N[C@@H](CCC(=O)O)…
|
| ZINC4523272 ZINC | 0.545 | 217.2 Da LogP -1.83 TPSA 135.5 | ✓ Ro5 | ✓ Clean |
C[C@@H](N)C(=O)N[C@H](CCC(N)=O)C(=O)O
|
| ZINC4545890 ZINC | 0.545 | 276.2 Da LogP -1.39 TPSA 167.0 | ✓ Ro5 | ✓ Clean |
N[C@H](CCC(=O)N[C@@H](CCC(=O)O)C(=O)O)C(=O)O
|
| ZINC4545891 ZINC | 0.545 | 276.2 Da LogP -1.39 TPSA 167.0 | ✓ Ro5 | ✓ Clean |
N[C@H](CCC(=O)N[C@H](CCC(=O)O)C(=O)O)C(=O)O
|
| ZINC4726537 ZINC | 0.538 | 453.4 Da LogP -2.47 TPSA 265.8 | ✓ Ro5 | Alert |
[N-]=[N+]=CC(=O)CC[C@H](NC(=O)[C@H](CCC(=O)C=[N…
|
| ZINC2390999 ZINC | 0.533 | 275.3 Da LogP -1.99 TPSA 172.8 | ✓ Ro5 | ✓ Clean |
NC(=O)CC[C@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)O
|
| ZINC2522662 ZINC | 0.533 | 217.3 Da LogP -0.97 TPSA 118.4 | ✓ Ro5 | ✓ Clean |
C[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)O
|
| ZINC2522687 ZINC | 0.533 | 273.3 Da LogP -0.55 TPSA 121.5 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@H](NC(=O)[C@H](C)N)C(=O)N[C@@H](C)C(=O…
|
| ZINC3014479 ZINC | 0.533 | 217.3 Da LogP -0.97 TPSA 118.4 | ✓ Ro5 | ✓ Clean |
C[C@@H](N)C(=O)N[C@@H](CCCCN)C(=O)O
|
| ZINC3014482 ZINC | 0.533 | 217.3 Da LogP -0.97 TPSA 118.4 | ✓ Ro5 | ✓ Clean |
C[C@H](N)C(=O)N[C@H](CCCCN)C(=O)O
|
| ZINC3014483 ZINC | 0.533 | 217.3 Da LogP -0.97 TPSA 118.4 | ✓ Ro5 | ✓ Clean |
C[C@@H](N)C(=O)N[C@H](CCCCN)C(=O)O
|
| ZINC15261332 ZINC | 0.531 | 303.3 Da LogP -1.99 TPSA 191.6 | 1 viol. | ✓ Clean |
N=C(N)NCCC[C@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)O
|
| ZINC5495961 ZINC | 0.529 | 362.3 Da LogP -3.64 TPSA 208.1 | 1 viol. | ✓ Clean |
C[C@H](N)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC…
|
| ZINC13507519 ZINC | 0.523 | 234.2 Da LogP -2.26 TPSA 150.0 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCC(=O)N[C@@H](CO)C(=O)O)C(=O)O
|
| ZINC2579085 ZINC | 0.521 | 245.3 Da LogP -1.83 TPSA 154.3 | 1 viol. | ✓ Clean |
C[C@H](N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)O
|
| ZINC8577164 ZINC | 0.521 | 245.3 Da LogP -1.83 TPSA 154.3 | 1 viol. | ✓ Clean |
C[C@@H](N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)O
|
| ZINC15721478 ZINC | 0.519 | 390.3 Da LogP -3.16 TPSA 225.2 | 1 viol. | ✓ Clean |
C[C@H](NC(=O)[C@H](CCC(=O)O)NC(=O)CNC(=O)[C@@H]…
|
| ZINC3873037 ZINC | 0.519 | 363.4 Da LogP -0.79 TPSA 158.8 | 1 viol. | ✓ Clean |
CC(C)[C@@H](NC(=O)[C@H](CS)NC(=O)CCC[C@H](N)C(=…
|
| ZINC2504764 ZINC | 0.511 | 232.2 Da LogP -0.84 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
CC[C@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)O
|
| ZINC2384788 ZINC | 0.500 | 260.3 Da LogP -0.21 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)O
|
| ZINC4899571 ZINC | 0.500 | 360.5 Da LogP -2.42 TPSA 199.6 | 1 viol. | ✓ Clean |
NCCC[C@H](N)C(=O)N[C@@H](CCCN)C(=O)N[C@@H](CCCN…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.