Genome KpKP13

Protein target profile

Putrescine transport system permease protein potI

Accession: KP13_04251

Gene: AHE45483.1 potI 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GM52
Export view
Length 255
Pocket druggability (P2Rank · AlphaFold DB model) 0.023
Functional annotation 0 EC 2 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Main supporting evidence

No similar human protein detected The current BLAST sequence screen did not find a significant human match, lowering apparent off-target risk. Core gene across strains Marked as conserved by both pan-genome tools: Roary and CoreCruncher. Strong predicted binding pocket FPocket selected-pocket score 0.93. This is a computational pocket signal, not binding validation. Structure available AlphaFold DB model + ColabFold model

Risks to review

Microbiome similarity 147 of 4744 screened genomes (3.1%) have a significant similarity hit. This target also has a predicted binding pocket (FPocket 0.93) — check the ligand evidence before deprioritizing on off-target risk alone. Weak second pocket-predictor signal P2Rank predicted binding-site probability 0.02.

Evidence gaps

No metabolic context No SBML/network-derived reaction evidence is loaded for this protein. No ligand evidence No experimental PDB ligands, measured ChEMBL bioactivity, or proposed ZINC compound records are available.
Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
3.1% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
41.87 Higher values support similarity to known essential genes.
DEG E-value
3.81e-60 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
89.21 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.023
Structure A0A0H3GM52
Pocket Pocket 1
Druggability (FPocket) 0.931
Structure A0A0H3GM52
Pocket Pocket 14
ColabFold model
P2Rank 0.057 · Pocket 1
FPocket 0.86 · Pocket 19
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 147 / 4744 genomes with a hit
Prevalence 3.1%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

UniProt A0A0H3GM52

Sequence

Primary amino-acid sequence viewer.

MLMLVIYSFNSSKLVTVWAGWSTRWYSELFHDDAMMSAVGLSLTIAACAATAAAILGTIAAVVMVRFGRFRGSNGFAFMITAPLVMPDVITGLSLLLLFVALGHAIGWPSDRGMLTIWLAHVTFCTAYVAVVISSRLRELDHSIEEAAMDLGAAPLKVFFVITLPMIMPAVISGWLLAFTLSLDDLVIASFVSGPGATTLPMLVFSSVRMGVNPEINALATLILGVVGIVGFIAWYLMARAEKQRVRDIQRARQG

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

2 GO

Subcellular localization

Localization
CytoplasmicMembrane

Gene Ontology (GO)

2
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0055085 The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

30 records
Show feature table
Start End DB Term Name
1 243 Gene3D G3DSA:1.10.3720.10 -
1 243 InterPro IPR035906 MetI-like superfamily
239 255 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
181 185 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
1 249 PANTHER PTHR43848 PUTRESCINE TRANSPORT SYSTEM PERMEASE PROTEIN POTI
39 234 ProSiteProfiles PS50928 ABC transporter integral membrane type-1 domain profile.
39 234 InterPro IPR000515 ABC transporter type 1, transmembrane domain MetI-like
115 137 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
207 217 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
138 157 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
56 230 CDD cd06261 TM_PBP2
56 230 InterPro IPR000515 ABC transporter type 1, transmembrane domain MetI-like
158 180 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
76 103 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
186 206 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
1 245 FunFam G3DSA:1.10.3720.10:FF:000040 Putrescine ABC transporter, permease protein PotI
218 238 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
65 75 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
78 100 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
55 247 Pfam PF00528 Binding-protein-dependent transport system inner membrane component
55 247 InterPro IPR000515 ABC transporter type 1, transmembrane domain MetI-like
43 65 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
216 238 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
1 240 SUPERFAMILY SSF161098 MetI-like
1 240 InterPro IPR035906 MetI-like superfamily
104 114 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
158 180 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
115 137 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
34 64 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
1 33 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.023
Likely same site as FPocket 14 5.4 Å 6 shared residues 86% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.006
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #14
0.931 Unusual size
Likely same site as P2Rank 1 5.4 Å 6 shared residues 86% of smaller site
Show in viewer
Surrounding area
Pocket 2 FPocket #4
0.533
Show in viewer
Surrounding area
Pocket 3 FPocket #22
0.356
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GM52
AlphaFold DB — — full sequence — Viewing
ColabFold KP13_04251
ColabFold — — full sequence — Loaded