Strong target candidate with converging metabolic, structural and chemical evidence.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 1.9% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 0.0 Higher values support similarity to known essential genes.
Structure confidence
- ColabFold pLDDT
- 92.63 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.
Sequence
Sequence
Primary amino-acid sequence viewer.
MQNYSLSGRRLGRQALLFPLCLVLYEFSTYIGNDMIQPGMLAVVQEFQVGNEWVPTSMTAYLAGGMFLQWLLGPLSDRIGRRPVMLTGVVWFIVTCLATLLAQTIEQFTLLRFLQGISLCFIGAVGYAAIQESFEEAVCIKITALMANVALIAPLLGPLVGAAWVHILPWEMMFVLFAVLAAISFFGLQRAMPETATRLGEKLSVKELGRDYRLVLKNLRFVAGALATGFVSLPLLAWIAQSPVIIISGEQATSYEYGMLQVPIFGALIAGNLVLARLTARRTVRSLIIMGGWPIMFGLILSAAATVVSSHAYLWMTAGLSFYAFGIGLANAGLVRLTLFASEMSKGTVSAAMGMLQMLIFTVGIELSKHAYELGGNGLFSLFNLLGGVLWLGLMIYFLKDKSVGNSQQG
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- CytoplasmicMembrane
Gene Ontology (GO)
7- GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
- GO:0022857 Enables the transfer of a substance, usually a specific substance or a group of related substances, from one side of a membrane to the other.
- GO:0055085 The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other.
- GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
- GO:0015385 Enables the transfer of a solute or solutes from one side of a membrane to the other according to the reaction: Na+(out) + H+(in) = Na+(in) + H+(out).
- GO:0046677 Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an antibiotic stimulus. An antibiotic is a chemical substance produced by a microorganism which has the capacity to inhibit the growth of or to kill other microorganisms.
- GO:1990961 A process that reduces or removes the toxicity of a xenobiotic by exporting it outside the cell.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 170 | 188 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 111 | 130 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 379 | 399 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 53 | 75 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 1 | 14 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 165 | 169 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 347 | 367 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 348 | 365 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 82 | 104 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 137 | 156 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 336 | 346 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 220 | 242 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 106 | 110 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 260 | 280 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 400 | 410 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 27 | 362 | Pfam | PF07690 | Major Facilitator Superfamily |
| 27 | 362 | InterPro | IPR011701 | Major facilitator superfamily |
| 15 | 33 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 219 | 240 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 189 | 218 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 34 | 52 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 14 | 405 | ProSiteProfiles | PS50850 | Major facilitator superfamily (MFS) profile. |
| 14 | 405 | InterPro | IPR020846 | Major facilitator superfamily domain |
| 108 | 130 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 166 | 188 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 313 | 335 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 286 | 308 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 287 | 307 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 308 | 312 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 380 | 399 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 21 | 399 | SUPERFAMILY | SSF103473 | MFS general substrate transporter |
| 21 | 399 | InterPro | IPR036259 | MFS transporter superfamily |
| 73 | 83 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 257 | 279 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 313 | 335 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 131 | 141 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 53 | 72 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 142 | 164 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 72 | 88 | ProSitePatterns | PS00216 | Sugar transport proteins signature 1. |
| 72 | 88 | InterPro | IPR005829 | Sugar transporter, conserved site |
| 368 | 378 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 281 | 286 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 16 | 38 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 19 | 375 | CDD | cd17320 | MFS_MdfA_MDR_like |
| 84 | 105 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 19 | 396 | PANTHER | PTHR23502 | MAJOR FACILITATOR SUPERFAMILY |
| 241 | 259 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 20 | 397 | Gene3D | G3DSA:1.20.1720.10 | Multidrug resistance protein D |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GQD8
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_04269
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural and bioactivity evidence are both available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| CLM RCSB PDB | P0AEY8 | 323.1 Da LogP 0.91 TPSA 112.7 | ✓ Ro5 | ✓ Clean |
c1cc(ccc1[C@H]([C@@H](CO)NC(=O)C(Cl)Cl)O)[N+](=…
|
|
| DXC RCSB PDB | P0AEY8 | 392.6 Da LogP 4.48 TPSA 77.8 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)O)[C@H]1CC[C@@H]2[C@@]1([C@H](C[C…
|
|
| KHJ RCSB PDB | P0AEY8 | 186.3 Da LogP 1.00 TPSA 7.8 | ✓ Ro5 | ✓ Clean |
C[n+]1ccc(cc1)c2cc[n+](cc2)C
|
|
| LDA RCSB PDB | P0AEY8 | 229.4 Da LogP 4.48 TPSA 23.1 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCC[N+](C)(C)[O-]
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
| Ligand | UniProt (homolog) | pchembl | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| CHEMBL333888 ChEMBL | P0AEY8 | 6.52 ~302.0 nM | 546.6 Da LogP 1.41 TPSA 181.6 | 2 viol. | ✓ Clean |
CC(C)CCSC[C@H]1c2cccc(O)c2C(=O)C2=C(O)[C@]3(O)C…
|
| CHEMBL339030 ChEMBL | P0AEY8 | 6.52 ~302.0 nM | 544.6 Da LogP 1.15 TPSA 181.6 | 2 viol. | ✓ Clean |
CN(C)[C@@H]1C(=O)C(C(N)=O)=C(O)[C@@]2(O)C(=O)C3…
|
| CHEMBL122262 ChEMBL | P0AEY8 | 6.40 ~398.1 nM | 532.6 Da LogP 1.02 TPSA 181.6 | 2 viol. | ✓ Clean |
CC(C)CSC[C@H]1c2cccc(O)c2C(=O)C2=C(O)[C@]3(O)C(…
|
| CHEMBL331492 ChEMBL | P0AEY8 | 6.40 ~398.1 nM | 528.6 Da LogP 2.18 TPSA 161.4 | 1 viol. | ✓ Clean |
CN(C)[C@@H]1C(=O)C(C(N)=O)=C(O)[C@@]2(O)C(=O)C3…
|
| CHEMBL420159 ChEMBL | P0AEY8 | 6.30 ~501.2 nM | 532.6 Da LogP 1.01 TPSA 181.6 | 2 viol. | ✓ Clean |
CN(C)[C@@H]1C(=O)C(C(N)=O)=C(O)[C@@]2(O)C(=O)C3…
|
| CHEMBL339999 ChEMBL | P0AEY8 | 6.22 ~602.6 nM | 558.7 Da LogP 1.54 TPSA 181.6 | 2 viol. | ✓ Clean |
CN(C)[C@@H]1C(=O)C(C(N)=O)=C(O)[C@@]2(O)C(=O)C3…
|
| CHEMBL421456 ChEMBL | P0AEY8 | 6.22 ~602.6 nM | 553.0 Da LogP 0.84 TPSA 181.6 | 2 viol. | ✓ Clean |
CN(C)[C@@H]1C(=O)C(C(N)=O)=C(O)[C@@]2(O)C(=O)C3…
|
| CHEMBL123933 ChEMBL | P0AEY8 | 6.16 ~691.8 nM | 518.6 Da LogP 0.77 TPSA 181.6 | 2 viol. | ✓ Clean |
CC(C)SC[C@H]1c2cccc(O)c2C(=O)C2=C(O)[C@]3(O)C(O…
|
| CHEMBL124794 ChEMBL | P0AEY8 | 6.16 ~691.8 nM | 582.6 Da LogP 0.42 TPSA 204.7 | 2 viol. | ✓ Clean |
CN(C)[C@@H]1C(=O)C(C(N)=O)=C(O)[C@@]2(O)C(=O)C3…
|
| CHEMBL125490 ChEMBL | P0AEY8 | 6.16 ~691.8 nM | 504.6 Da LogP 0.39 TPSA 181.6 | 2 viol. | ✓ Clean |
CCSC[C@H]1c2cccc(O)c2C(=O)C2=C(O)[C@]3(O)C(O)=C…
|
| CHEMBL338009 ChEMBL | P0AEY8 | 6.16 ~691.8 nM | 518.6 Da LogP 0.78 TPSA 181.6 | 2 viol. | ✓ Clean |
CCCSC[C@H]1c2cccc(O)c2C(=O)C2=C(O)[C@]3(O)C(O)=…
|
| CHEMBL122174 ChEMBL | P0AEY8 | 6.10 ~794.3 nM | 532.6 Da LogP 1.17 TPSA 181.6 | 2 viol. | ✓ Clean |
CCCCSC[C@H]1c2cccc(O)c2C(=O)C2=C(O)[C@]3(O)C(O)…
|
| CHEMBL334080 ChEMBL | P0AEY8 | 6.00 ~1.0 µM | 643.8 Da LogP 1.07 TPSA 180.1 | 3 viol. | ✓ Clean |
CN(C)[C@@H]1C(=O)C(C(=O)NCN2CCOCC2)=C(O)[C@@]2(…
|
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC12493596 ZINC | 1.000 | 392.6 Da LogP 4.48 TPSA 77.8 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)O)[C@H]1CC[C@H]2[C@@H]3CC[C@H]4C[…
|
| ZINC1849937 ZINC | 1.000 | 201.4 Da LogP 3.70 TPSA 23.1 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCC[N+](C)(C)[O-]
|
| ZINC2008702 ZINC | 1.000 | 243.4 Da LogP 4.87 TPSA 23.1 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCC[N+](C)(C)[O-]
|
| ZINC2039372 ZINC | 1.000 | 229.4 Da LogP 4.48 TPSA 23.1 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCC[N+](C)(C)[O-]
|
| ZINC2516963 ZINC | 1.000 | 215.4 Da LogP 4.09 TPSA 23.1 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCC[N+](C)(C)[O-]
|
| ZINC257356883 ZINC | 1.000 | 392.6 Da LogP 4.48 TPSA 77.8 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)O)[C@@H]1CC[C@@H]2[C@@H]3CC[C@H]4…
|
| ZINC257356885 ZINC | 1.000 | 392.6 Da LogP 4.48 TPSA 77.8 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)O)[C@@H]1CC[C@@H]2[C@@H]3CC[C@H]4…
|
| ZINC118912568 ZINC | 0.825 | 449.6 Da LogP 3.59 TPSA 106.9 | ✓ Ro5 | ✓ Clean |
C[C@@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@H]2[C@@H]3CC…
|
| ZINC118912569 ZINC | 0.825 | 449.6 Da LogP 3.59 TPSA 106.9 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@H]2[C@@H]3CC[…
|
| ZINC1857533486 ZINC | 0.825 | 449.6 Da LogP 3.59 TPSA 106.9 | ✓ Ro5 | ✓ Clean |
C[C@@H](CCC(=O)NCC(=O)O)[C@@H]1CC[C@H]2[C@@H]3C…
|
| ZINC1857533487 ZINC | 0.825 | 449.6 Da LogP 3.59 TPSA 106.9 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@@H]1CC[C@H]2[C@@H]3CC…
|
| ZINC253534396 ZINC | 0.825 | 449.6 Da LogP 3.59 TPSA 106.9 | ✓ Ro5 | ✓ Clean |
C[C@@H](CCC(=O)NCC(=O)O)[C@@H]1CC[C@@H]2[C@H]3C…
|
| ZINC253534397 ZINC | 0.825 | 449.6 Da LogP 3.59 TPSA 106.9 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@@H]1CC[C@@H]2[C@H]3CC…
|
| ZINC257358866 ZINC | 0.825 | 449.6 Da LogP 3.59 TPSA 106.9 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@@H]1CC[C@H]2[C@@H]3CC…
|
| ZINC257358867 ZINC | 0.825 | 449.6 Da LogP 3.59 TPSA 106.9 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@@H]1CC[C@H]2[C@@H]3CC…
|
| ZINC257358868 ZINC | 0.825 | 449.6 Da LogP 3.59 TPSA 106.9 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@@H]1CC[C@H]2[C@@H]3CC…
|
| ZINC257358869 ZINC | 0.825 | 449.6 Da LogP 3.59 TPSA 106.9 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@@H]1CC[C@H]2[C@@H]3CC…
|
| ZINC37245807 ZINC | 0.825 | 449.6 Da LogP 3.59 TPSA 106.9 | ✓ Ro5 | ✓ Clean |
C[C@@H](CCC(=O)NCC(=O)O)[C@@H]1CC[C@@H]2[C@H]3C…
|
| ZINC37245810 ZINC | 0.825 | 449.6 Da LogP 3.59 TPSA 106.9 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@@H]1CC[C@@H]2[C@H]3CC…
|
| ZINC59560281 ZINC | 0.825 | 449.6 Da LogP 3.59 TPSA 106.9 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@H]2[C@@H]3CC[…
|
| ZINC8837267 ZINC | 0.825 | 449.6 Da LogP 3.59 TPSA 106.9 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@H]2[C@@H]3CC[…
|
| ZINC257357698 ZINC | 0.811 | 378.6 Da LogP 4.09 TPSA 77.8 | ✓ Ro5 | ✓ Clean |
C[C@H](CC(=O)O)[C@@H]1CC[C@@H]2[C@@H]3CC[C@@H]4…
|
| ZINC31540161 ZINC | 0.811 | 378.6 Da LogP 4.09 TPSA 77.8 | ✓ Ro5 | ✓ Clean |
C[C@H](CC(=O)O)[C@H]1CC[C@H]2[C@@H]3CC[C@@H]4C[…
|
| ZINC118912986 ZINC | 0.804 | 406.6 Da LogP 4.57 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
COC(=O)CC[C@H](C)[C@H]1CC[C@H]2[C@@H]3CC[C@H]4C…
|
| ZINC118912988 ZINC | 0.804 | 406.6 Da LogP 4.57 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
COC(=O)CC[C@H](C)[C@H]1CC[C@H]2[C@@H]3CC[C@H]4C…
|
| ZINC118912989 ZINC | 0.804 | 406.6 Da LogP 4.57 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
COC(=O)CC[C@@H](C)[C@H]1CC[C@H]2[C@@H]3CC[C@H]4…
|
| ZINC119071953 ZINC | 0.804 | 406.6 Da LogP 4.57 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
COC(=O)CC[C@@H](C)[C@H]1CC[C@H]2[C@@H]3CC[C@@H]…
|
| ZINC12402838 ZINC | 0.804 | 406.6 Da LogP 4.57 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
COC(=O)CC[C@@H](C)[C@@H]1CC[C@@H]2[C@@H]3CC[C@@…
|
| ZINC12402839 ZINC | 0.804 | 406.6 Da LogP 4.57 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
COC(=O)CC[C@H](C)[C@@H]1CC[C@@H]2[C@@H]3CC[C@@H…
|
| ZINC1857741700 ZINC | 0.804 | 406.6 Da LogP 4.57 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
COC(=O)CC[C@H](C)[C@@H]1CC[C@H]2[C@@H]3CC[C@H]4…
|
| ZINC2160209 ZINC | 0.804 | 406.6 Da LogP 4.57 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
COC(=O)CC[C@@H](C)[C@@H]1CC[C@H]2[C@@H]3CC[C@H]…
|
| ZINC253497499 ZINC | 0.804 | 406.6 Da LogP 4.57 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
COC(=O)CC[C@@H](C)[C@@H]1CC[C@@H]2[C@H]3CC[C@H]…
|
| ZINC253497500 ZINC | 0.804 | 406.6 Da LogP 4.57 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
COC(=O)CC[C@H](C)[C@@H]1CC[C@@H]2[C@H]3CC[C@H]4…
|
| ZINC253497501 ZINC | 0.804 | 406.6 Da LogP 4.57 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
COC(=O)CC[C@H](C)[C@@H]1CC[C@@H]2[C@H]3CC[C@H]4…
|
| ZINC253497502 ZINC | 0.804 | 406.6 Da LogP 4.57 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
COC(=O)CC[C@@H](C)[C@@H]1CC[C@@H]2[C@H]3CC[C@H]…
|
| ZINC253507466 ZINC | 0.804 | 406.6 Da LogP 4.57 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
COC(=O)CC[C@H](C)[C@@H]1CC[C@@H]2[C@@H]3CC[C@@H…
|
| ZINC253507471 ZINC | 0.804 | 406.6 Da LogP 4.57 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
COC(=O)CC[C@H](C)[C@@H]1CC[C@@H]2[C@@H]3CC[C@@H…
|
| ZINC253507477 ZINC | 0.804 | 406.6 Da LogP 4.57 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
COC(=O)CC[C@H](C)[C@@H]1CC[C@@H]2[C@@H]3CC[C@@H…
|
| ZINC253610609 ZINC | 0.804 | 406.6 Da LogP 4.57 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
COC(=O)CC[C@@H](C)[C@@H]1CC[C@@H]2[C@@H]3CC[C@@…
|
| ZINC253610610 ZINC | 0.804 | 406.6 Da LogP 4.57 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
COC(=O)CC[C@@H](C)[C@@H]1CC[C@@H]2[C@@H]3CC[C@@…
|
| ZINC253610611 ZINC | 0.804 | 406.6 Da LogP 4.57 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
COC(=O)CC[C@@H](C)[C@@H]1CC[C@@H]2[C@@H]3CC[C@@…
|
| ZINC257359259 ZINC | 0.804 | 406.6 Da LogP 4.57 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
COC(=O)CC[C@H](C)[C@@H]1CC[C@@H]2[C@@H]3CC[C@H]…
|
| ZINC257359260 ZINC | 0.804 | 406.6 Da LogP 4.57 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
COC(=O)CC[C@H](C)[C@@H]1CC[C@@H]2[C@@H]3CC[C@H]…
|
| ZINC257359261 ZINC | 0.804 | 406.6 Da LogP 4.57 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
COC(=O)CC[C@H](C)[C@@H]1CC[C@@H]2[C@@H]3CC[C@H]…
|
| ZINC32296900 ZINC | 0.804 | 406.6 Da LogP 4.57 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
COC(=O)CC[C@H](C)[C@@H]1CC[C@H]2[C@@H]3CC[C@H]4…
|
| ZINC4081642 ZINC | 0.804 | 406.6 Da LogP 4.57 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
COC(=O)CC[C@@H](C)[C@H]1CC[C@H]2[C@@H]3CC[C@H]4…
|
| ZINC4081644 ZINC | 0.804 | 406.6 Da LogP 4.57 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
COC(=O)CC[C@@H](C)[C@H]1CC[C@@H]2[C@@H]3CC[C@H]…
|
| ZINC4081646 ZINC | 0.804 | 406.6 Da LogP 4.57 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
COC(=O)CC[C@@H](C)[C@H]1CC[C@H]2[C@@H]3CC[C@H]4…
|
| ZINC4081647 ZINC | 0.804 | 406.6 Da LogP 4.57 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
COC(=O)CC[C@@H](C)[C@H]1CC[C@@H]2[C@@H]3CC[C@H]…
|
| ZINC4429667 ZINC | 0.804 | 406.6 Da LogP 4.57 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
COC(=O)CC[C@@H](C)[C@H]1CC[C@H]2[C@@H]3CC[C@@H]…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.