KpKP13 Protein target profile
PTS system N-acetylglucosamine-specific EIICBA component
Accession: KP13_31488
Strong target candidate with converging metabolic, structural and chemical evidence.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 2.5% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 0.0 Higher values support similarity to known essential genes.
Structure confidence
- ColabFold pLDDT
- 86.34 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MNILGFFQRLGRALQLPIAVLPVAALLLRFGQPDLLNVPFIAQAGGAIFDNLALIFAIGVASSWSKDNAGSAALAGAVGYFVMTKAMVTINPEINMGVLAGIITGLVAGAVYNRWAGIKLPDFLSFFGGKRFVPIATGFFCLILAAIFGYVWPPVQHAIHSGGEWIVSAGALGSGIFGFINRLLIPTGLHQVLNTIAWFQIGEFTNAAGAVFHGDINRFYAGDGTAGMFMSGFFPIMMFGLPGAALAMYLAAPKARRPMVGGMLLSVAITAFLTGVTEPLEFLFMFLAPLLYLLHAVLTGISLFIATALGIHAGFSFSAGAIDYVLMYSLPAASKNVWMLLVMGVVFFFVYFLLFSAVIRMFNLKTPGREDKAADVVTEEANSNTEEGLTQLATSYIAAVGGTDNLKAIDACITRLRLTVGDSAKVNDAACKRLGASGVVKLNKQTIQVIVGAKAESIGDEMKKVVTRGPVAAAAAAPAGNVATAAPAAKPQAVANAKTVESLVSPITGDVVALEQVPDEAFASKAVGDGIAVKPTSNIVVAPAAGTVVKIFNTNHAFCLETNNGAEIVVHMGIDTVALEGKGFKRLVEEGTDVKAGEPILEMDLDFLNANARSMISPVVCSNSDDYSALVILASGKVVAGQTPLYEIKGK
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- CytoplasmicMembrane
Gene Ontology (GO)
9- GO:0019866 The inner, i.e. lumen-facing, lipid bilayer of an organelle envelope; usually highly selective to most ions and metabolites.
- GO:0015572 Enables the transfer of N-acetylglucosamine from one side of a membrane to the other. The D isomer of N-acetylglucosamine is a common structural unit of glycoproteins in plants, bacteria and animals; it is often the terminal sugar of an oligosaccharide group of a glycoprotein.
- GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
- GO:0009401 The uptake and phosphorylation of specific carbohydrates from the extracellular environment; uptake and phosphorylation are coupled, making the PTS a link between the uptake and metabolism of sugars; phosphoenolpyruvate is the original phosphate donor; phosphoenolpyruvate passes the phosphate via a signal transduction pathway, to enzyme 1 (E1), which in turn passes it on to the histidine protein, HPr; the next step in the system involves sugar-specific membrane-bound complex, enzyme 2 (EII), which transports the sugar into the cell; it includes the sugar permease, which catalyzes the transport reactions; EII is usually divided into three different domains, EIIA, EIIB, and EIIC.
- GO:0008982 Catalysis of the PEP-dependent, phosphoryl transfer-driven transport of substances across a membrane. The transport happens by catalysis of the reaction: protein N-phosphohistidine + sugar(out) = protein histidine + sugar phosphate(in). This differs from primary and secondary active transport in that the solute is modified during transport.
- GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
- GO:0016301 Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
- GO:0090563 Catalysis of the PEP-dependent, phosphoryl transfer-driven transport of substances across a membrane. The transport happens by catalysis of the reaction: protein S-phosphocysteine + sugar(out) = protein cysteine + sugar phosphate(in). This differs from primary and secondary active transport in that the solute is modified during transport.
- GO:0015764 The directed movement of N-acetylglucosamine into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 40 | 62 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 154 | 164 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 253 | 258 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 258 | 280 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 69 | 91 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 277 | 281 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 229 | 251 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 502 | 626 | Pfam | PF00358 | phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1 |
| 502 | 626 | InterPro | IPR001127 | Phosphotransferase system, sugar-specific permease EIIA type 1 |
| 360 | 452 | NCBIfam | TIGR00826 | glucose PTS transporter subunit EIIB |
| 360 | 452 | InterPro | IPR001996 | Phosphotransferase system, IIB component, type 1 |
| 388 | 467 | FunFam | G3DSA:3.30.1360.60:FF:000001 | PTS system glucose-specific IIBC component PtsG |
| 186 | 191 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 337 | 359 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 405 | 422 | ProSitePatterns | PS01035 | PTS EIIB domains cysteine phosphorylation site signature. |
| 405 | 422 | InterPro | IPR018113 | Phosphotransferase system EIIB, cysteine phosphorylation site |
| 307 | 312 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 493 | 650 | Gene3D | G3DSA:2.70.70.10 | Glucose Permease (Domain IIA) |
| 493 | 650 | InterPro | IPR011055 | Duplicated hybrid motif |
| 388 | 467 | Gene3D | G3DSA:3.30.1360.60 | Glucose permease domain IIB |
| 388 | 467 | InterPro | IPR036878 | Glucose permease domain IIB |
| 390 | 472 | ProSiteProfiles | PS51098 | PTS_EIIB type-1 domain profile. |
| 390 | 472 | InterPro | IPR001996 | Phosphotransferase system, IIB component, type 1 |
| 12 | 28 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 69 | 88 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 519 | 623 | ProSiteProfiles | PS51093 | PTS_EIIA type-1 domain profile. |
| 519 | 623 | InterPro | IPR001127 | Phosphotransferase system, sugar-specific permease EIIA type 1 |
| 313 | 331 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 192 | 214 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 192 | 212 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 131 | 153 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 498 | 646 | SUPERFAMILY | SSF51261 | Duplicated hybrid motif |
| 498 | 646 | InterPro | IPR011055 | Duplicated hybrid motif |
| 163 | 185 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 503 | 626 | CDD | cd00210 | PTS_IIA_glc |
| 29 | 39 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 96 | 118 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 13 | 30 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 113 | 131 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 259 | 276 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 282 | 306 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 503 | 623 | NCBIfam | TIGR00830 | glucose PTS transporter subunit IIA |
| 503 | 623 | InterPro | IPR001127 | Phosphotransferase system, sugar-specific permease EIIA type 1 |
| 63 | 68 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 213 | 231 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 295 | 317 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 94 | 112 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 165 | 185 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 565 | 577 | ProSitePatterns | PS00371 | PTS EIIA domains phosphorylation site signature 1. |
| 565 | 577 | InterPro | IPR001127 | Phosphotransferase system, sugar-specific permease EIIA type 1 |
| 360 | 651 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 332 | 336 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 12 | 300 | Pfam | PF02378 | Phosphotransferase system, EIIC |
| 12 | 300 | InterPro | IPR003352 | Phosphotransferase system, EIIC |
| 1 | 11 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 89 | 93 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 3 | 463 | NCBIfam | TIGR01998 | N-acetylglucosamine-specific PTS transporter subunit IIBC |
| 3 | 463 | InterPro | IPR010974 | Phosphotransferase system, N-acetylglucosamine-specific IIBC component |
| 390 | 464 | CDD | cd00212 | PTS_IIB_glc |
| 390 | 464 | InterPro | IPR018113 | Phosphotransferase system EIIB, cysteine phosphorylation site |
| 337 | 359 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 1 | 371 | ProSiteProfiles | PS51103 | PTS_EIIC type-1 domain profile. |
| 1 | 371 | InterPro | IPR013013 | Phosphotransferase system, EIIC component, type 1 |
| 396 | 427 | Pfam | PF00367 | phosphotransferase system, EIIB |
| 396 | 427 | InterPro | IPR018113 | Phosphotransferase system EIIB, cysteine phosphorylation site |
| 392 | 465 | SUPERFAMILY | SSF55604 | Glucose permease domain IIB |
| 392 | 465 | InterPro | IPR036878 | Glucose permease domain IIB |
| 232 | 252 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 2 | 468 | PANTHER | PTHR30009 | CYTOCHROME C-TYPE SYNTHESIS PROTEIN AND PTS TRANSMEMBRANE COMPONENT |
| 132 | 153 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 40 | 62 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 492 | 649 | FunFam | G3DSA:2.70.70.10:FF:000001 | PTS system glucose-specific IIA component |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Residue sets
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GQ78
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_31488
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
No virtual-screening candidates for this protein.
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.