Protein target profile

KP13_31889

Cold shock-like protein CspE

Genome: KpKP13 Gene: AHE45729.1 cspE 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GLC5
Length 69
Pocket druggability 0.026
Direct ligand evidence 0 24 total records
Functional annotation 0 EC 2 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
60.0 Lower values reduce human off-target concern.
Human E-value
6.4e-07
Gut microbiome similarity
35.9% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
70.149 Higher values support similarity to known essential genes.
DEG E-value
7.15e-31 Smaller values mean stronger essential-gene similarity.

Localization

Localization
Cytoplasmic

Structure confidence

ColabFold pLDDT
90.58 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.026
Structure A0A0H3GLC5
Pocket Pocket 1
P2Rank
Structure A0A0H3GLC5
Pocket No pockets
ColabFold model
FPocket 0.672 · Pocket 2
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 1701 / 4744 genomes with a hit
Prevalence 35.9%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

Primary amino-acid sequence viewer.

MSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQSNGFKTLAEGQRVEFEITNGAKGPSAANVIAL

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

2 GO

Gene Ontology (GO)

2
  • GO:0003676 Binding to a nucleic acid.
  • GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

25 records
Show feature table
Start End DB Term Name
1 69 PIRSF PIRSF002599 Cold_shock_A
1 69 InterPro IPR012156 Cold shock, CspA
47 69 Gene3D G3DSA:6.20.370.130 -
3 69 FunFam G3DSA:2.40.50.140:FF:000006 Cold shock protein CspC
5 69 SMART SM00357 csp_8
5 69 InterPro IPR011129 Cold shock domain
17 36 ProSitePatterns PS00352 Cold-shock (CSD) domain signature.
17 36 InterPro IPR019844 Cold-shock (CSD) domain
4 46 Gene3D G3DSA:2.40.50.140 -
4 46 InterPro IPR012340 Nucleic acid-binding, OB-fold
3 68 SUPERFAMILY SSF50249 Nucleic acid-binding proteins
3 68 InterPro IPR012340 Nucleic acid-binding, OB-fold
3 68 ProSiteProfiles PS51857 Cold-shock (CSD) domain profile.
3 68 InterPro IPR002059 Cold-shock protein, DNA-binding
3 68 PANTHER PTHR11544 COLD SHOCK DOMAIN CONTAINING PROTEINS
5 68 Pfam PF00313 'Cold-shock' DNA-binding domain
5 68 InterPro IPR002059 Cold-shock protein, DNA-binding
4 66 CDD cd04458 CSP_CDS
4 66 InterPro IPR002059 Cold-shock protein, DNA-binding
6 21 PRINTS PR00050 Cold shock protein signature
6 21 InterPro IPR002059 Cold-shock protein, DNA-binding
27 36 PRINTS PR00050 Cold shock protein signature
27 36 InterPro IPR002059 Cold-shock protein, DNA-binding
42 60 PRINTS PR00050 Cold shock protein signature
42 60 InterPro IPR002059 Cold-shock protein, DNA-binding

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GLC5
AlphaFold DB full sequence Viewing
ColabFold KP13_31889
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

24 records
Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 same-protein records
Transferred evidence 3 records from similar proteins
Structural ligands 1 0 loaded crystals
Measured bioactivity 2 direct and transferred ChEMBL records
Proposed compounds 21 similarity-based ZINC candidates
Best available ligand signal
NHE PDB via homolog 207.3 Da · LogP 0.80 · TPSA 66.4 Open detail RCSB PDB
DWT ChEMBL via homolog · pchembl 7.25 (~56.2 nM) Detail ChEMBL
CHEMBL4129274 ChEMBL via homolog Detail ChEMBL
ZINC1710230 ZINC proposed compound · Tanimoto 1.000 Detail ZINC
ZINC2004372 ZINC proposed compound · Tanimoto 0.786 Detail ZINC

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
NHE RCSB PDB P32081 207.3 Da LogP 0.80 TPSA 66.4 ✓ Ro5 ✓ Clean C1CCC(CC1)NCCS(=O)(=O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.