KpKP13 Protein target profile

putative bacterial antimicrobial peptide resistance protein PagP

Accession: KP13_03351

Gene: pagP AHE45730.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GPV4
Length 189
Pocket druggability (P2Rank · AlphaFold DB model) 0.9
Direct ligand evidence 0 51 total records
Functional annotation 1 EC 3 GO
Target summary

Strong target candidate with converging metabolic, structural and chemical evidence.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
1.9% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
84.416 Higher values support similarity to known essential genes.
DEG E-value
1.54e-101 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
86.95 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.9
Structure A0A0H3GPV4
Pocket Pocket 1
Druggability (FPocket) 0.894
Structure A0A0H3GPV4
Pocket Pocket 10
ColabFold model
P2Rank 0.922 · Pocket 1
FPocket 0.858 · Pocket 4
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 91 / 4744 genomes with a hit
Prevalence 1.9%

Sequence

Primary amino-acid sequence viewer.

MLRRFSLISLGFLGWLLVSGNASASFSSTLSEGYHTLSNNVAQTWNEPEHYDLYVPAITWHARFAYDKEKTDKYNERPWGAGFGVSRWDEKGNWHGLYLMAFKDSFNKWEPIGGYGWEKTWRPLTDQNFHLGLGYTLGVTARDNWNYIPIPVILPLASIGYGPATFQMTYIPGTYNNGNVYFAWARFQF

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 3 GO

Subcellular localization

Localization
OuterMembrane

Enzyme Commission (EC)

1

Gene Ontology (GO)

3
  • GO:0009279 A lipid bilayer that forms the outermost membrane of the cell envelope; enriched in polysaccharide and protein; the outer leaflet of the membrane contains specific lipopolysaccharide structures.
  • GO:0016409 Catalysis of the transfer of a palmitoyl (CH3-[CH2]14-CO-) group to an acceptor molecule.
  • GO:0009245 The chemical reactions and pathways resulting in the formation of lipid A, the glycolipid group of bacterial lipopolysaccharides, consisting of four to six fatty acyl chains linked to two glucosamine residues. Further modifications of the backbone are common.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

15 records
Show feature table
Start End DB Term Name
1 24 SignalP_GRAM_NEGATIVE SignalP-noTM SignalP-noTM
1 24 SignalP_GRAM_POSITIVE SignalP-TM SignalP-TM
29 189 FunFam G3DSA:2.40.160.20:FF:000002 Lipid A palmitoyltransferase PagP
35 189 SUPERFAMILY SSF56925 OMPA-like
35 189 InterPro IPR011250 Outer membrane protein/outer membrane enzyme PagP, beta-barrel
25 189 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
19 24 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
1 6 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
7 18 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
40 186 Pfam PF07017 Antimicrobial peptide resistance and lipid A acylation protein PagP
40 186 InterPro IPR009746 Llipid A acylation PagP
30 189 Gene3D G3DSA:2.40.160.20 -
1 24 Phobius SIGNAL_PEPTIDE Signal peptide region
2 189 Hamap MF_00837 Lipid A palmitoyltransferase PagP [pagP].
2 189 InterPro IPR009746 Llipid A acylation PagP

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.9
Likely same site as FPocket 15 4.1 Å 12 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.231
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.097
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.028
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #10
0.894
Show in viewer
Surrounding area
Pocket 2 FPocket #15
0.372
Likely same site as P2Rank 1 4.1 Å 12 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 3 FPocket #7
0.366
Show in viewer
Surrounding area
Residue sets
UniProt: Active site:106-106
UniProt: Active site:107-107
UniProt: Active site:63-63
UniProt: Site:177-177 Role in the phospholipid gating
UniProt: Site:72-72 Role in lipopolysaccharide recognition
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GPV4
AlphaFold DB full sequence Viewing
ColabFold KP13_03351
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

51 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 2 records from similar proteins
Structural ligands 2 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 49 similarity-based ZINC candidates
Best available ligand signal
LDA PDB via homolog 229.4 Da · LogP 4.48 · TPSA 23.1 Open detail RCSB PDB
SDS PDB via homolog Detail RCSB PDB
ZINC1532179 ZINC proposed compound · Tanimoto 1.000 Detail ZINC
ZINC1847701 ZINC proposed compound · Tanimoto 1.000 Detail ZINC
ZINC1849937 ZINC proposed compound · Tanimoto 1.000 Detail ZINC

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
LDA RCSB PDB P37001 229.4 Da LogP 4.48 TPSA 23.1 ✓ Ro5 ✓ Clean CCCCCCCCCCCC[N+](C)(C)[O-]
SDS RCSB PDB P37001 266.4 Da LogP 3.73 TPSA 63.6 ✓ Ro5 ✓ Clean CCCCCCCCCCCCOS(=O)(=O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.