KpKP13 Protein target profile

Inositol-1-monophosphatase

Accession: KP13_03379

Gene: AHE45758.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GJW0
Length 269
Pocket druggability (P2Rank · AlphaFold DB model) 0.823
Direct ligand evidence 0 60 total records
Functional annotation 1 EC 5 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
35.0 Lower values reduce human off-target concern.
Human E-value
2.58e-06
Gut microbiome similarity
0.5% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
92.75 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.823
Structure A0A0H3GJW0
Pocket Pocket 1
Druggability (FPocket) 0.242
Structure A0A0H3GJW0
Pocket Pocket 12
ColabFold model
P2Rank 0.901 · Pocket 1
FPocket 0.1 · Pocket 6
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 23 / 4744 genomes with a hit
Prevalence 0.5%

Sequence

Primary amino-acid sequence viewer.

MQSQESEALQARYRLACELAKAGAELAFEYYQQREALTVDHKGDDLQDVVSVADKRVEAFVKQRIQSAFPEDGFLGEESGARLPDARVLWVVDPIDGTSCFLNGLHTWCLSLAIVADGEPVIGVVYDPNHRELFHALRGHGAWLNDAPIRPHPATMVKEGVMGVGTSHRVTPADFLPFLQALLSDGGMFIRNGSGALMSAWAAAGRLIGYYEPHMNPWDALPGLVLMREAGGASNDFLAQEGIQRGNPLLLASPTLYPQLKKMIPQPLH

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 5 GO

Subcellular localization

Localization
Cytoplasmic

Enzyme Commission (EC)

1

Gene Ontology (GO)

5
  • GO:0008934 Catalysis of the reaction: 1D-myo-inositol 1-phosphate + H2O = myo-inositol + phosphate.
  • GO:0046872 Binding to a metal ion.
  • GO:0006020 The chemical reactions and pathways involving inositol, 1,2,3,4,5,6-cyclohexanehexol, a growth factor for animals and microorganisms.
  • GO:0007165 The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
  • GO:0031564 A positive regulation of gene expression mechanism that allows RNA polymerase to continue transcription beyond a termination site, thus allowing expression of downstream genes under specific conditions.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

21 records
Show feature table
Start End DB Term Name
12 239 Pfam PF00459 Inositol monophosphatase family
12 239 InterPro IPR000760 Inositol monophosphatase-like
157 267 Gene3D G3DSA:3.40.190.80 -
8 149 FunFam G3DSA:3.30.540.10:FF:000003 Inositol-1-monophosphatase
9 240 PANTHER PTHR20854 INOSITOL MONOPHOSPHATASE
2 152 Gene3D G3DSA:3.30.540.10 -
90 106 PRINTS PR00377 Inositol monophosphatase superfamily signature
90 106 InterPro IPR000760 Inositol monophosphatase-like
215 239 PRINTS PR00377 Inositol monophosphatase superfamily signature
215 239 InterPro IPR000760 Inositol monophosphatase-like
48 68 PRINTS PR00377 Inositol monophosphatase superfamily signature
48 68 InterPro IPR000760 Inositol monophosphatase-like
139 162 PRINTS PR00377 Inositol monophosphatase superfamily signature
139 162 InterPro IPR000760 Inositol monophosphatase-like
184 205 PRINTS PR00377 Inositol monophosphatase superfamily signature
184 205 InterPro IPR000760 Inositol monophosphatase-like
70 86 PRINTS PR00377 Inositol monophosphatase superfamily signature
70 86 InterPro IPR000760 Inositol monophosphatase-like
10 265 SUPERFAMILY SSF56655 Carbohydrate phosphatase
90 103 ProSitePatterns PS00629 Inositol monophosphatase family signature 1.
90 103 InterPro IPR020583 Inositol monophosphatase, metal-binding site

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.823
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.116
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.094
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #12
0.242
Show in viewer
Surrounding area
Residue sets
UniProt: Binding site:219-219
UniProt: Binding site:77-77
UniProt: Binding site:93-93
UniProt: Binding site:95-95
UniProt: Binding site:96-96
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GJW0
AlphaFold DB full sequence Viewing
ColabFold KP13_03379
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

60 records
Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 same-protein records
Transferred evidence 10 records from similar proteins
Structural ligands 4 0 loaded crystals
Measured bioactivity 6 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
IPD PDB via homolog 258.1 Da · LogP -4.98 · TPSA 173.6 Open detail RCSB PDB
PE4 PDB via homolog Detail RCSB PDB
PG0 PDB via homolog Detail RCSB PDB
SRT PDB via homolog Detail RCSB PDB
CHEMBL286326 ChEMBL via homolog · pchembl 7.10 (~79.4 nM) Detail ChEMBL

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
IPD RCSB PDB A0A1I9GET0 258.1 Da LogP -4.98 TPSA 173.6 ✓ Ro5 ✓ Clean [C@H]1([C@H](C([C@@H]([C@@H](C1O)O)O)OP(=O)([O-…
PE4 RCSB PDB P0ADG4 354.4 Da LogP 0.11 TPSA 84.8 ✓ Ro5 ✓ Clean CCOCCOCCOCCOCCOCCOCCOCCO
PG0 RCSB PDB Q2FVV7 120.1 Da LogP -0.36 TPSA 38.7 ✓ Ro5 ✓ Clean COCCOCCO
SRT RCSB PDB O33832 150.1 Da LogP -2.12 TPSA 115.1 ✓ Ro5 ✓ Clean [C@H]([C@H](C(=O)O)O)(C(=O)O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.