Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 43.077 Lower values reduce human off-target concern.
- Human E-value
- 5.23e-08
- Gut microbiome similarity
- 0.3% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 0.0 Higher values support similarity to known essential genes.
Structure confidence
- ColabFold pLDDT
- 96.76 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MFPSHLPTPRRPAAQSIPILRWGIIGPGWIAERFVHSLKTYSRQQVVAVASRSQAKADRVAAEWGIPQAYGQVEEMLARPDIDAVYIATPHNHHFPDGMQALKAGKHVLIEKPFALNLGEGRELQAEAARQEKLALEAMWCDYAPKYDVIRQLLEDGALGDLHTLLADHGEYFTRDHRIFNADLAGGPMMDLGSYVTSFALMVGGMPQEIVARGSATAEGLNGQTSMLFSWQNGMQGMLNTTLFSNTPGGAVVAGRQATLTIDGQFYAPGGFTLAASQGGQVLRWEEPRNRYDQLFWQAEHFAWCIGQGLQDSPLRPLSRVLQNLQVMDEVRRQVGAVFNEER
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Unknown
Gene Ontology (GO)
2- GO:0000166 Binding to a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
- GO:0016491 Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 10 | 136 | Gene3D | G3DSA:3.40.50.720 | - |
| 145 | 306 | SUPERFAMILY | SSF55347 | Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain |
| 20 | 134 | Pfam | PF01408 | Oxidoreductase family, NAD-binding Rossmann fold |
| 20 | 134 | InterPro | IPR000683 | Gfo/Idh/MocA-like oxidoreductase, N-terminal |
| 18 | 341 | PANTHER | PTHR22604 | OXIDOREDUCTASES |
| 19 | 165 | SUPERFAMILY | SSF51735 | NAD(P)-binding Rossmann-fold domains |
| 19 | 165 | InterPro | IPR036291 | NAD(P)-binding domain superfamily |
| 138 | 343 | Gene3D | G3DSA:3.30.360.10 | Dihydrodipicolinate Reductase; domain 2 |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GKU7
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_32006
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 2HA RCSB PDB | Q9TQS6 | 90.1 Da LogP -1.46 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
C(C(=O)CO)O
|
|
| AC6 RCSB PDB | Q9TQS6 | 136.1 Da LogP 1.59 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CC(=O)c1ccc(cc1)O
|
|
| BLA RCSB PDB | P72782 | 582.7 Da LogP 4.81 TPSA 160.9 | 1 viol. | ✓ Clean |
Cc1c(c([nH]c1\C=C/2\C(=C(C(=O)N2)C=C)C)\C=C/3\C…
|
|
| CJX RCSB PDB | Q6L737 | 485.5 Da LogP -7.26 TPSA 276.8 | 2 viol. | ✓ Clean |
C1[C@@H]([C@H]([C@@H]([C@H]([C@@H]1N)O[C@@H]2[C…
|
|
| CK0 RCSB PDB | Q6L737 | 484.5 Da LogP -7.29 TPSA 282.6 | 2 viol. | ✓ Clean |
C1[C@@H]([C@H]([C@@H]([C@H]([C@@H]1N)O[C@@H]2[C…
|
|
| SIN RCSB PDB | Q07982 | 118.1 Da LogP -0.06 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
C(CC(=O)O)C(=O)O
|
|
| TLO RCSB PDB | B3TMR8 | 478.3 Da LogP 0.81 TPSA 186.6 | ✓ Ro5 | ✓ Clean |
CC1=CN(C(=O)NC1=O)[C@H]2C[C@@H]([C@H](O2)CO[P@]…
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC17654095 ZINC | 0.895 | 484.5 Da LogP -7.29 TPSA 282.6 | 2 viol. | ✓ Clean |
NC[C@@H]1O[C@@H](O[C@@H]2[C@@H](N)C[C@@H](N)[C@…
|
| ZINC1857793042 ZINC | 0.895 | 484.5 Da LogP -7.29 TPSA 282.6 | 2 viol. | ✓ Clean |
NC[C@H]1O[C@H](O[C@@H]2[C@@H](N)C[C@@H](N)[C@H]…
|
| ZINC239203289 ZINC | 0.895 | 484.5 Da LogP -7.29 TPSA 282.6 | 2 viol. | ✓ Clean |
NC[C@@H]1O[C@H](O[C@H]2[C@@H](O)[C@@H](O[C@@H]3…
|
| ZINC239203290 ZINC | 0.895 | 484.5 Da LogP -7.29 TPSA 282.6 | 2 viol. | ✓ Clean |
NC[C@@H]1O[C@H](O[C@H]2[C@@H](O)[C@@H](O[C@@H]3…
|
| ZINC239203291 ZINC | 0.895 | 484.5 Da LogP -7.29 TPSA 282.6 | 2 viol. | ✓ Clean |
NC[C@@H]1O[C@H](O[C@H]2[C@@H](O)[C@@H](O[C@@H]3…
|
| ZINC239203292 ZINC | 0.895 | 484.5 Da LogP -7.29 TPSA 282.6 | 2 viol. | ✓ Clean |
NC[C@@H]1O[C@H](O[C@H]2[C@@H](O)[C@@H](O[C@@H]3…
|
| ZINC242649355 ZINC | 0.895 | 484.5 Da LogP -7.29 TPSA 282.6 | 2 viol. | ✓ Clean |
NC[C@@H]1O[C@H](O[C@H]2[C@@H](N)C[C@@H](N)[C@H]…
|
| ZINC242649358 ZINC | 0.895 | 484.5 Da LogP -7.29 TPSA 282.6 | 2 viol. | ✓ Clean |
NC[C@@H]1O[C@H](O[C@H]2[C@@H](N)C[C@@H](N)[C@H]…
|
| ZINC242649360 ZINC | 0.895 | 484.5 Da LogP -7.29 TPSA 282.6 | 2 viol. | ✓ Clean |
NC[C@@H]1O[C@H](O[C@H]2[C@@H](N)C[C@@H](N)[C@H]…
|
| ZINC242649362 ZINC | 0.895 | 484.5 Da LogP -7.29 TPSA 282.6 | 2 viol. | ✓ Clean |
NC[C@@H]1O[C@H](O[C@H]2[C@@H](N)C[C@@H](N)[C@H]…
|
| ZINC245224172 ZINC | 0.895 | 484.5 Da LogP -7.29 TPSA 282.6 | 2 viol. | ✓ Clean |
NC[C@@H]1O[C@@H](O[C@@H]2[C@H](N)C[C@H](N)[C@@H…
|
| ZINC245224173 ZINC | 0.895 | 484.5 Da LogP -7.29 TPSA 282.6 | 2 viol. | ✓ Clean |
NC[C@@H]1O[C@@H](O[C@@H]2[C@H](N)C[C@H](N)[C@@H…
|
| ZINC245224174 ZINC | 0.895 | 484.5 Da LogP -7.29 TPSA 282.6 | 2 viol. | ✓ Clean |
NC[C@@H]1O[C@@H](O[C@@H]2[C@H](N)C[C@H](N)[C@@H…
|
| ZINC245224175 ZINC | 0.895 | 484.5 Da LogP -7.29 TPSA 282.6 | 2 viol. | ✓ Clean |
NC[C@@H]1O[C@@H](O[C@@H]2[C@H](N)C[C@H](N)[C@@H…
|
| ZINC43470138 ZINC | 0.895 | 484.5 Da LogP -7.29 TPSA 282.6 | 2 viol. | ✓ Clean |
NC[C@H]1O[C@@H](O[C@@H]2[C@@H](N)C[C@@H](N)[C@H…
|
| ZINC8101132 ZINC | 0.895 | 484.5 Da LogP -7.29 TPSA 282.6 | 2 viol. | ✓ Clean |
NC[C@@H]1O[C@H](O[C@H]2[C@@H](O)[C@@H](O[C@H]3O…
|
| ZINC8101133 ZINC | 0.895 | 484.5 Da LogP -7.29 TPSA 282.6 | 2 viol. | ✓ Clean |
NC[C@@H]1O[C@H](O[C@H]2[C@@H](O)[C@@H](O[C@H]3O…
|
| ZINC8101134 ZINC | 0.895 | 484.5 Da LogP -7.29 TPSA 282.6 | 2 viol. | ✓ Clean |
NC[C@@H]1O[C@H](O[C@H]2[C@@H](O)[C@H](O[C@H]3O[…
|
| ZINC8101135 ZINC | 0.895 | 484.5 Da LogP -7.29 TPSA 282.6 | 2 viol. | ✓ Clean |
NC[C@@H]1O[C@H](O[C@H]2[C@@H](O)[C@H](O[C@H]3O[…
|
| ZINC8214590 ZINC | 0.895 | 484.5 Da LogP -7.29 TPSA 282.6 | 2 viol. | ✓ Clean |
NC[C@H]1O[C@H](O[C@@H]2[C@@H](N)C[C@@H](N)[C@H]…
|
| ZINC8217403 ZINC | 0.895 | 484.5 Da LogP -7.29 TPSA 282.6 | 2 viol. | ✓ Clean |
NC[C@H]1O[C@H](O[C@@H]2[C@@H](N)C[C@@H](N)[C@H]…
|
| ZINC29123659 ZINC | 0.850 | 212.2 Da LogP 3.26 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CC(=O)c1ccc(-c2ccc(O)cc2)cc1
|
| ZINC100029245 ZINC | 0.829 | 468.5 Da LogP -6.26 TPSA 262.4 | 2 viol. | ✓ Clean |
NC[C@@H]1O[C@H](O[C@H]2[C@@H](O)[C@@H](O[C@@H]3…
|
| ZINC100029247 ZINC | 0.829 | 468.5 Da LogP -6.26 TPSA 262.4 | 2 viol. | ✓ Clean |
NC[C@@H]1O[C@H](O[C@H]2[C@@H](O)[C@@H](O[C@@H]3…
|
| ZINC100029250 ZINC | 0.829 | 468.5 Da LogP -6.26 TPSA 262.4 | 2 viol. | ✓ Clean |
NC[C@@H]1O[C@H](O[C@H]2[C@@H](O)[C@H](O[C@@H]3C…
|
| ZINC100029253 ZINC | 0.829 | 468.5 Da LogP -6.26 TPSA 262.4 | 2 viol. | ✓ Clean |
NC[C@@H]1O[C@H](O[C@H]2[C@@H](O)[C@H](O[C@@H]3C…
|
| ZINC245204761 ZINC | 0.829 | 468.5 Da LogP -6.26 TPSA 262.4 | 2 viol. | ✓ Clean |
NC[C@@H]1O[C@H](O[C@H]2[C@@H](O)[C@@H](O[C@@H]3…
|
| ZINC245204762 ZINC | 0.829 | 468.5 Da LogP -6.26 TPSA 262.4 | 2 viol. | ✓ Clean |
NC[C@@H]1O[C@H](O[C@H]2[C@@H](O)[C@@H](O[C@@H]3…
|
| ZINC245204763 ZINC | 0.829 | 468.5 Da LogP -6.26 TPSA 262.4 | 2 viol. | ✓ Clean |
NC[C@@H]1O[C@H](O[C@H]2[C@@H](O)[C@@H](O[C@@H]3…
|
| ZINC13507072 ZINC | 0.793 | 482.2 Da LogP -1.16 TPSA 244.1 | 2 viol. | ✓ Clean |
Cc1cn([C@@H]2C[C@@H](O)[C@H](CO[P@@](=O)(O)O[P@…
|
| ZINC33979251 ZINC | 0.793 | 482.2 Da LogP -1.16 TPSA 244.1 | 2 viol. | ✓ Clean |
Cc1cn([C@@H]2C[C@H](O)[C@H](CO[P@@](=O)(O)O[P@@…
|
| ZINC12503053 ZINC | 0.789 | 402.2 Da LogP -1.28 TPSA 197.6 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@@H]2C[C@H](O)[C@@H](CO[P@@](=O)(O)OP(=…
|
| ZINC33979243 ZINC | 0.789 | 402.2 Da LogP -1.28 TPSA 197.6 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@@H]2C[C@H](O)[C@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC33979244 ZINC | 0.789 | 402.2 Da LogP -1.28 TPSA 197.6 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@H]2C[C@H](O)[C@H](CO[P@@](=O)(O)OP(=O)…
|
| ZINC33979245 ZINC | 0.789 | 402.2 Da LogP -1.28 TPSA 197.6 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@@H]2C[C@@H](O)[C@H](CO[P@@](=O)(O)OP(=…
|
| ZINC33979246 ZINC | 0.789 | 402.2 Da LogP -1.28 TPSA 197.6 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@H]2C[C@@H](O)[C@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC8215882 ZINC | 0.789 | 402.2 Da LogP -1.28 TPSA 197.6 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@H]2C[C@H](O)[C@@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC256001609 ZINC | 0.780 | 483.5 Da LogP -7.33 TPSA 288.4 | 2 viol. | ✓ Clean |
NC[C@@H]1O[C@H](O[C@@H]2[C@H](N)C[C@H](N)[C@H](…
|
| ZINC256001610 ZINC | 0.780 | 483.5 Da LogP -7.33 TPSA 288.4 | 2 viol. | ✓ Clean |
NC[C@@H]1O[C@H](O[C@@H]2[C@H](N)C[C@H](N)[C@H](…
|
| ZINC256001611 ZINC | 0.780 | 483.5 Da LogP -7.33 TPSA 288.4 | 2 viol. | ✓ Clean |
NC[C@@H]1O[C@H](O[C@@H]2[C@H](N)C[C@H](N)[C@H](…
|
| ZINC256001612 ZINC | 0.780 | 483.5 Da LogP -7.33 TPSA 288.4 | 2 viol. | ✓ Clean |
NC[C@@H]1O[C@H](O[C@@H]2[C@H](N)C[C@H](N)[C@H](…
|
| ZINC53132258 ZINC | 0.780 | 483.5 Da LogP -7.33 TPSA 288.4 | 2 viol. | ✓ Clean |
NC[C@H]1O[C@H](O[C@@H]2[C@@H](N)C[C@@H](N)[C@H]…
|
| ZINC77301567 ZINC | 0.780 | 483.5 Da LogP -7.33 TPSA 288.4 | 2 viol. | ✓ Clean |
NC[C@H]1O[C@H](O[C@H]2[C@H](N)C[C@H](N)[C@@H](O…
|
| ZINC254509393 ZINC | 0.739 | 240.3 Da LogP 4.01 TPSA 62.0 | ✓ Ro5 | Alert |
CC(=O)c1ccc(N=Nc2ccc(O)cc2)cc1
|
| ZINC100052153 ZINC | 0.738 | 454.5 Da LogP -6.65 TPSA 262.4 | 2 viol. | ✓ Clean |
NC[C@H]1O[C@H](O[C@@H]2[C@@H](N)C[C@@H](N)[C@H]…
|
| ZINC242575106 ZINC | 0.738 | 454.5 Da LogP -6.65 TPSA 262.4 | 2 viol. | ✓ Clean |
NC[C@@H]1O[C@H](O[C@H]2[C@@H](O[C@@H]3O[C@H](CO…
|
| ZINC242575109 ZINC | 0.738 | 454.5 Da LogP -6.65 TPSA 262.4 | 2 viol. | ✓ Clean |
NC[C@@H]1O[C@H](O[C@H]2[C@@H](O[C@@H]3O[C@H](CO…
|
| ZINC43664297 ZINC | 0.738 | 454.5 Da LogP -6.65 TPSA 262.4 | 2 viol. | ✓ Clean |
NC[C@@H]1O[C@H](O[C@H]2[C@@H](O[C@H]3O[C@@H](CO…
|
| ZINC43664300 ZINC | 0.738 | 454.5 Da LogP -6.65 TPSA 262.4 | 2 viol. | ✓ Clean |
NC[C@@H]1O[C@H](O[C@H]2[C@@H](O[C@H]3O[C@@H](CO…
|
| ZINC43664303 ZINC | 0.738 | 454.5 Da LogP -6.65 TPSA 262.4 | 2 viol. | ✓ Clean |
NC[C@@H]1O[C@H](O[C@H]2[C@@H](O[C@H]3O[C@@H](CO…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.