KpKP13 Protein target profile

Phosphoribosylaminoimidazole carboxylase catalytic subunit

Accession: KP13_03593

Gene: AHE45936.1 purE 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GJC7
Length 169
Pocket druggability (P2Rank · AlphaFold DB model) 0.235
Direct ligand evidence 0 82 total records
Functional annotation 1 EC 2 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
26.389 Lower values reduce human off-target concern.
Human E-value
1.36e-07
Gut microbiome similarity
29.4% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
66.667 Higher values support similarity to known essential genes.
DEG E-value
1.28e-74 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
95.93 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.235
Structure A0A0H3GJC7
Pocket Pocket 1
Druggability (FPocket) 0.468
Structure A0A0H3GJC7
Pocket Pocket 12
ColabFold model
P2Rank 0.2 · Pocket 1
FPocket 0.534 · Pocket 10
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 1393 / 4744 genomes with a hit
Prevalence 29.4%

Sequence

Primary amino-acid sequence viewer.

MSSRNNSARIAIVMGSKSDWATMQFTAEILDALNVPYHVEVVSAHRTPDKLFSFAESAESHGYQVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIPVGTLAIGKAGAANAGLLAAQILAQHDAELHQRLSAWRQAQTDEVLDNPDPRGAA

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 2 GO

Subcellular localization

Localization
Unknown

Enzyme Commission (EC)

1

Gene Ontology (GO)

2
  • GO:0006189 The chemical reactions and pathways resulting in the formation of IMP, inosine monophosphate, by the stepwise assembly of a purine ring on ribose 5-phosphate.
  • GO:0034023 Catalysis of the reaction: 5-carboxyamino-1-(5-phospho-D-ribosyl)imidazole = 5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxylate.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

15 records
Show feature table
Start End DB Term Name
5 166 PIRSF PIRSF001338 AIR_carboxylase
5 166 InterPro IPR024694 PurE, prokaryotic type
10 163 NCBIfam TIGR01162 5-(carboxyamino)imidazole ribonucleotide mutase
10 163 InterPro IPR000031 PurE domain
10 157 Pfam PF00731 AIR carboxylase
10 157 InterPro IPR000031 PurE domain
9 165 SUPERFAMILY SSF52255 N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)
3 164 PANTHER PTHR23046 PHOSPHORIBOSYLAMINOIMIDAZOLE CARBOXYLASE CATALYTIC SUBUNIT
3 164 InterPro IPR024694 PurE, prokaryotic type
8 159 SMART SM01001 AIRC_2
8 159 InterPro IPR000031 PurE domain
1 169 Gene3D G3DSA:3.40.50.1970 -
1 169 FunFam G3DSA:3.40.50.1970:FF:000004 N5-carboxyaminoimidazole ribonucleotide mutase
10 163 Hamap MF_01929 N5-carboxyaminoimidazole ribonucleotide mutase [purE].
10 163 InterPro IPR033747 Class I PurE

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.235
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.057
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #12
0.468
Show in viewer
Surrounding area
Residue sets
UniProt: Binding site:16-16
UniProt: Binding site:19-19
UniProt: Binding site:46-46
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GJC7
AlphaFold DB full sequence Viewing
ColabFold KP13_03593
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

82 records
Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 same-protein records
Transferred evidence 32 records from similar proteins
Structural ligands 9 0 loaded crystals
Measured bioactivity 23 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
AIR PDB via homolog 295.2 Da · LogP -1.81 · TPSA 160.3 Open detail RCSB PDB
ANP PDB via homolog Detail RCSB PDB
C2R PDB via homolog Detail RCSB PDB
CO2 PDB via homolog Detail RCSB PDB
F6R PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
AIR RCSB PDB P0AG18 295.2 Da LogP -1.81 TPSA 160.3 ✓ Ro5 ✓ Clean c1c(n(cn1)[C@H]2[C@@H]([C@@H]([C@H](O2)COP(=O)(…
ANP RCSB PDB P22234 506.2 Da LogP -2.06 TPSA 281.9 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
C2R RCSB PDB P0AG18 339.2 Da LogP -2.11 TPSA 197.6 1 viol. ✓ Clean c1nc(c(n1[C@H]2[C@@H]([C@@H]([C@H](O2)COP(=O)(O…
CO2 RCSB PDB P22234 44.0 Da LogP -0.58 TPSA 34.1 ✓ Ro5 ✓ Clean C(=O)=O
F6R RCSB PDB Q5NGE9 260.1 Da LogP -3.26 TPSA 164.8 1 viol. ✓ Clean C([C@H]([C@H]([C@@H](C(=O)CO)O)O)O)OP(=O)(O)O
ICR RCSB PDB Q2QJL3 339.2 Da LogP -2.68 TPSA 193.2 1 viol. ✓ Clean [H]/N=C\1/[C@@H](N=CN1[C@H]2[C@@H]([C@@H]([C@H]…
NIA RCSB PDB P0AG18 340.2 Da LogP -1.90 TPSA 203.4 ✓ Ro5 ✓ Clean c1nc(c(n1[C@H]2[C@@H]([C@@H]([C@H](O2)COP(=O)(O…
OK8 RCSB PDB P22234 454.3 Da LogP -3.15 TPSA 264.0 2 viol. ✓ Clean c1nc(c(n1[C@H]2[C@@H]([C@@H]([C@H](O2)COP(=O)(O…
RLK RCSB PDB P22234 515.4 Da LogP 1.68 TPSA 125.0 1 viol. ✓ Clean CN(C)CCCS(=O)(=O)N1CCN(CC1)c2ccc(c(c2)NC(=O)c3c…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.