KpKP13 Protein target profile
Phosphoribosylaminoimidazole carboxylase catalytic subunit
Accession: KP13_03593
Target candidate with partial support; inspect missing evidence before prioritizing.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 26.389 Lower values reduce human off-target concern.
- Human E-value
- 1.36e-07
- Gut microbiome similarity
- 29.4% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 66.667 Higher values support similarity to known essential genes.
- DEG E-value
- 1.28e-74 Smaller values mean stronger essential-gene similarity.
Structure confidence
- ColabFold pLDDT
- 95.93 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MSSRNNSARIAIVMGSKSDWATMQFTAEILDALNVPYHVEVVSAHRTPDKLFSFAESAESHGYQVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIPVGTLAIGKAGAANAGLLAAQILAQHDAELHQRLSAWRQAQTDEVLDNPDPRGAA
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Unknown
Enzyme Commission (EC)
1Gene Ontology (GO)
2- GO:0006189 The chemical reactions and pathways resulting in the formation of IMP, inosine monophosphate, by the stepwise assembly of a purine ring on ribose 5-phosphate.
- GO:0034023 Catalysis of the reaction: 5-carboxyamino-1-(5-phospho-D-ribosyl)imidazole = 5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxylate.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 5 | 166 | PIRSF | PIRSF001338 | AIR_carboxylase |
| 5 | 166 | InterPro | IPR024694 | PurE, prokaryotic type |
| 10 | 163 | NCBIfam | TIGR01162 | 5-(carboxyamino)imidazole ribonucleotide mutase |
| 10 | 163 | InterPro | IPR000031 | PurE domain |
| 10 | 157 | Pfam | PF00731 | AIR carboxylase |
| 10 | 157 | InterPro | IPR000031 | PurE domain |
| 9 | 165 | SUPERFAMILY | SSF52255 | N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) |
| 3 | 164 | PANTHER | PTHR23046 | PHOSPHORIBOSYLAMINOIMIDAZOLE CARBOXYLASE CATALYTIC SUBUNIT |
| 3 | 164 | InterPro | IPR024694 | PurE, prokaryotic type |
| 8 | 159 | SMART | SM01001 | AIRC_2 |
| 8 | 159 | InterPro | IPR000031 | PurE domain |
| 1 | 169 | Gene3D | G3DSA:3.40.50.1970 | - |
| 1 | 169 | FunFam | G3DSA:3.40.50.1970:FF:000004 | N5-carboxyaminoimidazole ribonucleotide mutase |
| 10 | 163 | Hamap | MF_01929 | N5-carboxyaminoimidazole ribonucleotide mutase [purE]. |
| 10 | 163 | InterPro | IPR033747 | Class I PurE |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Residue sets
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GJC7
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_03593
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural and bioactivity evidence are both available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| AIR RCSB PDB | P0AG18 | 295.2 Da LogP -1.81 TPSA 160.3 | ✓ Ro5 | ✓ Clean |
c1c(n(cn1)[C@H]2[C@@H]([C@@H]([C@H](O2)COP(=O)(…
|
|
| ANP RCSB PDB | P22234 | 506.2 Da LogP -2.06 TPSA 281.9 | 3 viol. | ✓ Clean |
c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
|
|
| C2R RCSB PDB | P0AG18 | 339.2 Da LogP -2.11 TPSA 197.6 | 1 viol. | ✓ Clean |
c1nc(c(n1[C@H]2[C@@H]([C@@H]([C@H](O2)COP(=O)(O…
|
|
| CO2 RCSB PDB | P22234 | 44.0 Da LogP -0.58 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
C(=O)=O
|
|
| F6R RCSB PDB | Q5NGE9 | 260.1 Da LogP -3.26 TPSA 164.8 | 1 viol. | ✓ Clean |
C([C@H]([C@H]([C@@H](C(=O)CO)O)O)O)OP(=O)(O)O
|
|
| ICR RCSB PDB | Q2QJL3 | 339.2 Da LogP -2.68 TPSA 193.2 | 1 viol. | ✓ Clean |
[H]/N=C\1/[C@@H](N=CN1[C@H]2[C@@H]([C@@H]([C@H]…
|
|
| NIA RCSB PDB | P0AG18 | 340.2 Da LogP -1.90 TPSA 203.4 | ✓ Ro5 | ✓ Clean |
c1nc(c(n1[C@H]2[C@@H]([C@@H]([C@H](O2)COP(=O)(O…
|
|
| OK8 RCSB PDB | P22234 | 454.3 Da LogP -3.15 TPSA 264.0 | 2 viol. | ✓ Clean |
c1nc(c(n1[C@H]2[C@@H]([C@@H]([C@H](O2)COP(=O)(O…
|
|
| RLK RCSB PDB | P22234 | 515.4 Da LogP 1.68 TPSA 125.0 | 1 viol. | ✓ Clean |
CN(C)CCCS(=O)(=O)N1CCN(CC1)c2ccc(c(c2)NC(=O)c3c…
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
| Ligand | UniProt (homolog) | pchembl | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| CHEMBL4439335 ChEMBL | P22234 | 8.00 ~10.0 nM | 411.9 Da LogP 3.23 TPSA 96.4 | ✓ Ro5 | ✓ Clean |
Nc1nc(C(=O)Nc2cc(-c3ccc(CN4CCNCC4)cc3)ccc2Cl)co1
|
| CHEMBL4446674 ChEMBL | P22234 | 8.00 ~10.0 nM | 388.9 Da LogP 3.03 TPSA 111.0 | ✓ Ro5 | ✓ Clean |
CCNCCCn1cc(-c2ccc(Cl)c(NC(=O)c3coc(N)n3)c2)cn1
|
| CHEMBL4518584 ChEMBL | P22234 | 8.00 ~10.0 nM | 360.8 Da LogP 2.25 TPSA 111.0 | ✓ Ro5 | ✓ Clean |
CNCCn1cc(-c2ccc(Cl)c(NC(=O)c3coc(N)n3)c2)cn1
|
| CHEMBL4536252 ChEMBL | P22234 | 8.00 ~10.0 nM | 415.9 Da LogP 3.56 TPSA 106.5 | ✓ Ro5 | ✓ Clean |
CN(C)CCCOc1ccc(-c2ccc(Cl)c(NC(=O)c3coc(N)n3)c2)…
|
| CHEMBL4546611 ChEMBL | P22234 | 8.00 ~10.0 nM | 443.9 Da LogP 2.66 TPSA 105.5 | ✓ Ro5 | ✓ Clean |
CN1CCN(CCCn2cc(-c3ccc(Cl)c(NC(=O)c4coc(N)n4)c3)…
|
| CHEMBL4575613 ChEMBL | P22234 | 8.00 ~10.0 nM | 440.9 Da LogP 3.41 TPSA 109.3 | ✓ Ro5 | ✓ Clean |
CN1CCC(NCc2ccc(-c3ccc(Cl)c(NC(=O)c4coc(N)n4)c3)…
|
| CHEMBL4593253 ChEMBL | P22234 | 8.00 ~10.0 nM | 400.9 Da LogP 3.17 TPSA 111.0 | ✓ Ro5 | ✓ Clean |
Nc1nc(C(=O)Nc2cc(-c3cnn(CCCNC4CC4)c3)ccc2Cl)co1
|
| CHEMBL4444329 ChEMBL | P22234 | 7.60 ~25.1 nM | 421.9 Da LogP 3.62 TPSA 106.5 | ✓ Ro5 | ✓ Clean |
CN(C)CCCOc1nc(-c2ccc(Cl)c(NC(=O)c3coc(N)n3)c2)c…
|
| CHEMBL4445038 ChEMBL | P22234 | 7.60 ~25.1 nM | 426.9 Da LogP 2.97 TPSA 100.5 | ✓ Ro5 | ✓ Clean |
CN1CCN(Cc2ccc(-c3ccc(Cl)c(NC(=O)c4coc(N)n4)c3)c…
|
| CHEMBL4446513 ChEMBL | P22234 | 7.60 ~25.1 nM | 400.9 Da LogP 3.77 TPSA 93.6 | ✓ Ro5 | ✓ Clean |
CN(C)CCOc1ccc(-c2ccc(Cl)c(NC(=O)c3coc(N)n3)c2)c…
|
| CHEMBL4454750 ChEMBL | P22234 | 7.60 ~25.1 nM | 402.8 Da LogP 2.56 TPSA 119.4 | ✓ Ro5 | ✓ Clean |
CN(C)CCOc1ncc(-c2ccc(Cl)c(NC(=O)c3coc(N)n3)c2)c…
|
| CHEMBL4458444 ChEMBL | P22234 | 7.60 ~25.1 nM | 429.9 Da LogP 2.27 TPSA 105.5 | ✓ Ro5 | ✓ Clean |
CN1CCN(CCn2cc(-c3ccc(Cl)c(NC(=O)c4coc(N)n4)c3)c…
|
| CHEMBL4462176 ChEMBL | P22234 | 7.60 ~25.1 nM | 427.5 Da LogP 3.62 TPSA 106.5 | ✓ Ro5 | ✓ Clean |
CSc1ccc(-c2ccc(OCCCN(C)C)nc2)cc1NC(=O)c1coc(N)n1
|
| CHEMBL4466767 ChEMBL | P22234 | 7.60 ~25.1 nM | 457.9 Da LogP 2.24 TPSA 131.3 | ✓ Ro5 | ✓ Clean |
CN1CCC(NC(=O)Cn2cc(-c3ccc(Cl)c(NC(=O)c4coc(N)n4…
|
| CHEMBL4470155 ChEMBL | P22234 | 7.60 ~25.1 nM | 415.9 Da LogP 3.56 TPSA 106.5 | ✓ Ro5 | ✓ Clean |
CN(C)CCCOc1ccc(-c2ccc(Cl)c(NC(=O)c3coc(N)n3)c2)…
|
| CHEMBL4473997 ChEMBL | P22234 | 7.60 ~25.1 nM | 401.9 Da LogP 3.16 TPSA 106.5 | ✓ Ro5 | ✓ Clean |
CN(C)CCOc1ccc(-c2ccc(Cl)c(NC(=O)c3coc(N)n3)c2)c…
|
| CHEMBL4476811 ChEMBL | P22234 | 7.60 ~25.1 nM | 471.9 Da LogP 2.44 TPSA 122.5 | ✓ Ro5 | ✓ Clean |
CN(C)CCC(=O)N1CC(Cn2cc(-c3ccc(Cl)c(NC(=O)c4coc(…
|
| CHEMBL4516092 ChEMBL | P22234 | 7.60 ~25.1 nM | 412.9 Da LogP 2.63 TPSA 109.3 | ✓ Ro5 | ✓ Clean |
Nc1nc(C(=O)Nc2cc(-c3ccc(CN4CCNCC4)nc3)ccc2Cl)co1
|
| CHEMBL4538041 ChEMBL | P22234 | 7.60 ~25.1 nM | 471.9 Da LogP 2.58 TPSA 122.5 | ✓ Ro5 | ✓ Clean |
CN(C)C1CCN(C(=O)Cn2cc(-c3ccc(Cl)c(NC(=O)c4coc(N…
|
| CHEMBL4570990 ChEMBL | P22234 | 7.60 ~25.1 nM | 388.9 Da LogP 2.98 TPSA 102.2 | ✓ Ro5 | ✓ Clean |
CN(C)CCCn1cc(-c2ccc(Cl)c(NC(=O)c3coc(N)n3)c2)cn1
|
| CHEMBL4585820 ChEMBL | P22234 | 7.60 ~25.1 nM | 415.9 Da LogP 1.93 TPSA 114.2 | ✓ Ro5 | ✓ Clean |
Nc1nc(C(=O)Nc2cc(-c3cnn(CCN4CCNCC4)c3)ccc2Cl)co1
|
| CHEMBL4590239 ChEMBL | P22234 | 7.60 ~25.1 nM | 431.9 Da LogP 1.70 TPSA 131.3 | ✓ Ro5 | ✓ Clean |
CN(C)CCNC(=O)Cn1cc(-c2ccc(Cl)c(NC(=O)c3coc(N)n3…
|
| CHEMBL554752 ChEMBL | P38024 | 6.41 ~389.0 nM | 340.2 Da LogP -1.90 TPSA 203.4 | ✓ Ro5 | ✓ Clean |
Nc1c([N+](=O)[O-])cnn1[C@@H]1O[C@H](COP(=O)(O)O…
|
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC100065511 ZINC | 1.000 | 260.1 Da LogP -3.26 TPSA 164.8 | 1 viol. | ✓ Clean |
O=C(CO)[C@H](O)[C@H](O)[C@@H](O)COP(=O)(O)O
|
| ZINC100085043 ZINC | 1.000 | 260.1 Da LogP -3.26 TPSA 164.8 | 1 viol. | ✓ Clean |
O=C(CO)[C@H](O)[C@H](O)[C@H](O)COP(=O)(O)O
|
| ZINC104869937 ZINC | 1.000 | 260.1 Da LogP -3.26 TPSA 164.8 | 1 viol. | ✓ Clean |
O=C(CO)[C@H](O)[C@@H](O)[C@@H](O)COP(=O)(O)O
|
| ZINC13537943 ZINC | 1.000 | 260.1 Da LogP -3.26 TPSA 164.8 | 1 viol. | ✓ Clean |
O=C(CO)[C@H](O)[C@@H](O)[C@H](O)COP(=O)(O)O
|
| ZINC4096533 ZINC | 1.000 | 339.2 Da LogP -2.11 TPSA 197.6 | 1 viol. | ✓ Clean |
Nc1c(C(=O)O)ncn1[C@@H]1O[C@H](COP(=O)(O)O)[C@@H…
|
| ZINC85994845 ZINC | 1.000 | 260.1 Da LogP -3.26 TPSA 164.8 | 1 viol. | ✓ Clean |
O=C(CO)[C@@H](O)[C@H](O)[C@H](O)COP(=O)(O)O
|
| ZINC5132038 ZINC | 0.897 | 290.2 Da LogP -3.90 TPSA 185.0 | 1 viol. | ✓ Clean |
O=C(CO)[C@@H](O)[C@H](O)[C@H](O)[C@H](O)COP(=O)…
|
| ZINC103317774 ZINC | 0.833 | 338.2 Da LogP -2.71 TPSA 203.4 | 1 viol. | ✓ Clean |
NC(=O)c1ncn([C@@H]2O[C@H](COP(=O)(O)O)[C@H](O)[…
|
| ZINC12501010 ZINC | 0.833 | 338.2 Da LogP -2.71 TPSA 203.4 | 1 viol. | ✓ Clean |
NC(=O)c1ncn([C@@H]2O[C@H](COP(=O)(O)O)[C@@H](O)…
|
| ZINC22048479 ZINC | 0.833 | 338.2 Da LogP -2.71 TPSA 203.4 | 1 viol. | ✓ Clean |
NC(=O)c1ncn([C@@H]2O[C@H](COP(=O)(O)O)[C@H](O)[…
|
| ZINC3869390 ZINC | 0.833 | 338.2 Da LogP -2.71 TPSA 203.4 | 1 viol. | ✓ Clean |
NC(=O)c1ncn([C@H]2O[C@@H](COP(=O)(O)O)[C@@H](O)…
|
| ZINC3869391 ZINC | 0.833 | 338.2 Da LogP -2.71 TPSA 203.4 | 1 viol. | ✓ Clean |
NC(=O)c1ncn([C@@H]2O[C@@H](COP(=O)(O)O)[C@@H](O…
|
| ZINC3869392 ZINC | 0.833 | 338.2 Da LogP -2.71 TPSA 203.4 | 1 viol. | ✓ Clean |
NC(=O)c1ncn([C@H]2O[C@@H](COP(=O)(O)O)[C@@H](O)…
|
| ZINC3869393 ZINC | 0.833 | 338.2 Da LogP -2.71 TPSA 203.4 | 1 viol. | ✓ Clean |
NC(=O)c1ncn([C@@H]2O[C@@H](COP(=O)(O)O)[C@@H](O…
|
| ZINC4096500 ZINC | 0.833 | 338.2 Da LogP -2.71 TPSA 203.4 | 1 viol. | ✓ Clean |
NC(=O)c1ncn([C@@H]2O[C@H](COP(=O)(O)O)[C@@H](O)…
|
| ZINC1529626 ZINC | 0.793 | 230.1 Da LogP -2.62 TPSA 144.5 | ✓ Ro5 | ✓ Clean |
O=C(CO)[C@H](O)[C@@H](O)COP(=O)(O)O
|
| ZINC1532567 ZINC | 0.793 | 230.1 Da LogP -2.62 TPSA 144.5 | ✓ Ro5 | ✓ Clean |
O=C(CO)[C@H](O)[C@H](O)COP(=O)(O)O
|
| ZINC1532851 ZINC | 0.793 | 230.1 Da LogP -2.62 TPSA 144.5 | ✓ Ro5 | ✓ Clean |
O=C(CO)[C@@H](O)[C@@H](O)COP(=O)(O)O
|
| ZINC30320708 ZINC | 0.793 | 230.1 Da LogP -2.62 TPSA 144.5 | ✓ Ro5 | ✓ Clean |
O=C(CO)[C@@H](O)[C@H](O)COP(=O)(O)O
|
| ZINC12502210 ZINC | 0.742 | 340.1 Da LogP -3.14 TPSA 211.3 | 1 viol. | ✓ Clean |
O=C(COP(=O)(O)O)[C@H](O)[C@H](O)[C@@H](O)COP(=O…
|
| ZINC12502212 ZINC | 0.742 | 340.1 Da LogP -3.14 TPSA 211.3 | 1 viol. | ✓ Clean |
O=C(COP(=O)(O)O)[C@H](O)[C@H](O)[C@H](O)COP(=O)…
|
| ZINC12502214 ZINC | 0.742 | 340.1 Da LogP -3.14 TPSA 211.3 | 1 viol. | ✓ Clean |
O=C(COP(=O)(O)O)[C@H](O)[C@@H](O)[C@@H](O)COP(=…
|
| ZINC12502216 ZINC | 0.742 | 340.1 Da LogP -3.14 TPSA 211.3 | 1 viol. | ✓ Clean |
O=C(COP(=O)(O)O)[C@H](O)[C@@H](O)[C@H](O)COP(=O…
|
| ZINC4523251 ZINC | 0.742 | 340.1 Da LogP -3.14 TPSA 211.3 | 1 viol. | ✓ Clean |
O=C(COP(=O)(O)O)[C@@H](O)[C@@H](O)[C@@H](O)COP(…
|
| ZINC4523255 ZINC | 0.742 | 340.1 Da LogP -3.14 TPSA 211.3 | 1 viol. | ✓ Clean |
O=C(COP(=O)(O)O)[C@@H](O)[C@@H](O)[C@H](O)COP(=…
|
| ZINC4523257 ZINC | 0.742 | 340.1 Da LogP -3.14 TPSA 211.3 | 1 viol. | ✓ Clean |
O=C(COP(=O)(O)O)[C@@H](O)[C@H](O)[C@@H](O)COP(=…
|
| ZINC4523259 ZINC | 0.742 | 340.1 Da LogP -3.14 TPSA 211.3 | 1 viol. | ✓ Clean |
O=C(COP(=O)(O)O)[C@@H](O)[C@H](O)[C@H](O)COP(=O…
|
| ZINC4096553 ZINC | 0.732 | 454.3 Da LogP -3.15 TPSA 264.0 | 2 viol. | ✓ Clean |
Nc1c(C(=O)N[C@@H](CC(=O)O)C(=O)O)ncn1[C@@H]1O[C…
|
| ZINC1532902 ZINC | 0.700 | 206.2 Da LogP -0.86 TPSA 132.1 | ✓ Ro5 | ✓ Clean |
O=C(O)CC[C@@](O)(CC(=O)O)C(=O)O
|
| ZINC2018106 ZINC | 0.700 | 206.2 Da LogP -0.86 TPSA 132.1 | ✓ Ro5 | ✓ Clean |
O=C(O)CC[C@](O)(CC(=O)O)C(=O)O
|
| ZINC4879884 ZINC | 0.694 | 260.2 Da LogP -2.02 TPSA 156.9 | ✓ Ro5 | ✓ Clean |
Nc1c([N+](=O)[O-])ncn1[C@H]1O[C@@H](CO)[C@@H](O…
|
| ZINC4879885 ZINC | 0.694 | 260.2 Da LogP -2.02 TPSA 156.9 | ✓ Ro5 | ✓ Clean |
Nc1c([N+](=O)[O-])ncn1[C@@H]1O[C@@H](CO)[C@@H](…
|
| ZINC4879887 ZINC | 0.694 | 260.2 Da LogP -2.02 TPSA 156.9 | ✓ Ro5 | ✓ Clean |
Nc1c([N+](=O)[O-])ncn1[C@H]1O[C@@H](CO)[C@@H](O…
|
| ZINC4879888 ZINC | 0.694 | 260.2 Da LogP -2.02 TPSA 156.9 | ✓ Ro5 | ✓ Clean |
Nc1c([N+](=O)[O-])ncn1[C@@H]1O[C@@H](CO)[C@@H](…
|
| ZINC88466335 ZINC | 0.660 | 338.2 Da LogP -2.71 TPSA 203.4 | 1 viol. | ✓ Clean |
NC(=O)c1c(N)ncn1[C@@H]1O[C@H](COP(=O)(O)O)[C@@H…
|
| ZINC5809524 ZINC | 0.654 | 324.2 Da LogP -3.05 TPSA 190.2 | ✓ Ro5 | ✓ Clean |
Nc1ncn([C@H]2O[C@@H](COP(=O)(O)O)[C@@H](O)[C@H]…
|
| ZINC5809525 ZINC | 0.654 | 324.2 Da LogP -3.05 TPSA 190.2 | ✓ Ro5 | ✓ Clean |
Nc1ncn([C@@H]2O[C@@H](COP(=O)(O)O)[C@@H](O)[C@H…
|
| ZINC3593496 ZINC | 0.652 | 206.2 Da LogP -1.16 TPSA 121.1 | ✓ Ro5 | ✓ Clean |
COC(=O)C[C@@](O)(CC(=O)O)C(=O)O
|
| ZINC3593497 ZINC | 0.652 | 206.2 Da LogP -1.16 TPSA 121.1 | ✓ Ro5 | ✓ Clean |
COC(=O)C[C@](O)(CC(=O)O)C(=O)O
|
| ZINC1532524 ZINC | 0.640 | 323.2 Da LogP -2.45 TPSA 177.4 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@H]2O[C@@H](COP(=O)(O)O)[C@H](O)[C@@H]…
|
| ZINC16546001 ZINC | 0.640 | 323.2 Da LogP -2.45 TPSA 177.4 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2O[C@H](COP(=O)(O)O)[C@H](O)[C@@H]…
|
| ZINC1785780 ZINC | 0.640 | 323.2 Da LogP -2.45 TPSA 177.4 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2O[C@H](COP(=O)(O)O)[C@@H](O)[C@@H…
|
| ZINC1785781 ZINC | 0.640 | 323.2 Da LogP -2.45 TPSA 177.4 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@H]2O[C@H](COP(=O)(O)O)[C@@H](O)[C@@H]…
|
| ZINC3861744 ZINC | 0.640 | 323.2 Da LogP -2.45 TPSA 177.4 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2O[C@H](COP(=O)(O)O)[C@@H](O)[C@H]…
|
| ZINC3869480 ZINC | 0.640 | 323.2 Da LogP -2.45 TPSA 177.4 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@H]2O[C@@H](COP(=O)(O)O)[C@@H](O)[C@H]…
|
| ZINC3869482 ZINC | 0.640 | 323.2 Da LogP -2.45 TPSA 177.4 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@H]2O[C@@H](COP(=O)(O)O)[C@@H](O)[C@@H…
|
| ZINC3954230 ZINC | 0.640 | 323.2 Da LogP -2.45 TPSA 177.4 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@H]2O[C@@H](COP(=O)(O)O)[C@H](O)[C@H]2…
|
| ZINC8613159 ZINC | 0.640 | 323.2 Da LogP -2.45 TPSA 177.4 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2O[C@H](COP(=O)(O)O)[C@H](O)[C@H]2…
|
| ZINC8952080 ZINC | 0.640 | 323.2 Da LogP -2.45 TPSA 177.4 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2O[C@@H](COP(=O)(O)O)[C@H](O)[C@@H…
|
| ZINC9007749 ZINC | 0.640 | 323.2 Da LogP -2.45 TPSA 177.4 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2O[C@@H](COP(=O)(O)O)[C@H](O)[C@H]…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.