KpKP13 Protein target profile

Adenylate kinase

Accession: KP13_03617

Gene: adk AHE45959.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GJA6
Length 214
Pocket druggability (P2Rank · AlphaFold DB model) 0.971
Direct ligand evidence 0 56 total records
Functional annotation 1 EC 7 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
58.511 Lower values reduce human off-target concern.
Human E-value
3.59e-34
Gut microbiome similarity
25.9% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
96.729 Higher values support similarity to known essential genes.
DEG E-value
8.899999999999999e-153 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
95.86 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.971
Structure A0A0H3GJA6
Pocket Pocket 1
Druggability (FPocket) 0.967
Structure A0A0H3GJA6
Pocket Pocket 2
ColabFold model
P2Rank 0.97 · Pocket 1
FPocket 0.974 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 1230 / 4744 genomes with a hit
Prevalence 25.9%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

Primary amino-acid sequence viewer.

MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGITVDYVLEFDVPDELIVDRIVGRRVHAASGRVYHIKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYTKEAQAGNTKYAKVDGTKAVADVRAELEKILG

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 7 GO

Subcellular localization

Localization
Cytoplasmic

Enzyme Commission (EC)

1

Gene Ontology (GO)

7
  • GO:0004017 Catalysis of the reaction: ATP + AMP = 2 ADP.
  • GO:0019205 Catalysis of the transfer of a phosphate group, usually from ATP or GTP, to a nucleobase, nucleoside, nucleotide or polynucleotide substrate.
  • GO:0016776 Catalysis of the transfer of a phosphorus-containing group from one compound (donor) to a phosphate group (acceptor).
  • GO:0006139 Any cellular metabolic process involving nucleobases, nucleosides, nucleotides and nucleic acids.
  • GO:0005524 Binding to ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
  • GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
  • GO:0044209 The chemical reactions and pathways resulting in the formation of adenosine monophosphate (AMP) from derivatives of it (either adenine, ADP or adenosine 3',5'-bisphosphate) without de novo synthesis.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

33 records
Show feature table
Start End DB Term Name
1 2 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
2 205 CDD cd01428 ADK
2 205 InterPro IPR000850 Adenylate kinase/UMP-CMP kinase
13 17 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
3 12 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
1 214 FunFam G3DSA:3.40.50.300:FF:000106 Adenylate kinase mitochondrial
18 214 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
173 187 PRINTS PR00094 Adenylate kinase signature
173 187 InterPro IPR000850 Adenylate kinase/UMP-CMP kinase
81 97 PRINTS PR00094 Adenylate kinase signature
81 97 InterPro IPR000850 Adenylate kinase/UMP-CMP kinase
4 17 PRINTS PR00094 Adenylate kinase signature
4 17 InterPro IPR000850 Adenylate kinase/UMP-CMP kinase
32 46 PRINTS PR00094 Adenylate kinase signature
32 46 InterPro IPR000850 Adenylate kinase/UMP-CMP kinase
156 171 PRINTS PR00094 Adenylate kinase signature
156 171 InterPro IPR000850 Adenylate kinase/UMP-CMP kinase
1 214 Hamap MF_00235 Adenylate kinase [adk].
1 214 InterPro IPR000850 Adenylate kinase/UMP-CMP kinase
2 208 PANTHER PTHR23359 NUCLEOTIDE KINASE
2 208 InterPro IPR000850 Adenylate kinase/UMP-CMP kinase
5 186 Pfam PF00406 Adenylate kinase
1 212 SUPERFAMILY SSF52540 P-loop containing nucleoside triphosphate hydrolases
1 212 InterPro IPR027417 P-loop containing nucleoside triphosphate hydrolase
81 92 ProSitePatterns PS00113 Adenylate kinase signature.
81 92 InterPro IPR033690 Adenylate kinase, conserved site
1 213 Gene3D G3DSA:3.40.50.300 -
1 213 InterPro IPR027417 P-loop containing nucleoside triphosphate hydrolase
123 158 Pfam PF05191 Adenylate kinase, active site lid
123 158 InterPro IPR007862 Adenylate kinase, active site lid domain
1 17 Phobius SIGNAL_PEPTIDE Signal peptide region
2 213 NCBIfam TIGR01351 adenylate kinase
2 213 InterPro IPR006259 Adenylate kinase subfamily

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.971
Likely same site as FPocket 2 5.9 Å 30 shared residues 91% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.048
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.015
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #2
0.967 Unusual size
Likely same site as P2Rank 1 5.9 Å 30 shared residues 91% of smaller site
Show in viewer
Surrounding area
Pocket 2 FPocket #11
0.308 Unusual size
Show in viewer
Surrounding area
Residue sets
UniProt: Binding site:10-15
UniProt: Binding site:123-123
UniProt: Binding site:132-133
UniProt: Binding site:156-156
UniProt: Binding site:167-167
UniProt: Binding site:200-200
UniProt: Binding site:31-31
UniProt: Binding site:36-36
UniProt: Binding site:57-59
UniProt: Binding site:85-88
UniProt: Binding site:92-92
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GJA6
AlphaFold DB full sequence Viewing
ColabFold KP13_03617
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

56 records
Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 same-protein records
Transferred evidence 6 records from similar proteins
Structural ligands 5 0 loaded crystals
Measured bioactivity 1 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
ANP PDB via homolog 506.2 Da · LogP -2.06 · TPSA 281.9 Open detail RCSB PDB
AP5 PDB via homolog Detail RCSB PDB
ATF PDB via homolog Detail RCSB PDB
GCP PDB via homolog Detail RCSB PDB
JPY PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
ANP RCSB PDB P69441 506.2 Da LogP -2.06 TPSA 281.9 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
AP5 RCSB PDB A0A0J9X1X4 916.4 Da LogP -2.33 TPSA 480.5 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
ATF RCSB PDB P07170 541.2 Da LogP -0.93 TPSA 269.9 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
GCP RCSB PDB P69441 521.2 Da LogP -2.22 TPSA 289.9 3 viol. ✓ Clean c1nc2c(n1[C@H]3[C@@H]([C@@H]([C@H](O3)CO[P@](=O…
JPY RCSB PDB A0A0J9X1X4 273.3 Da LogP 4.22 TPSA 29.1 ✓ Ro5 ✓ Clean CC(=O)NCc1ccc2ccc3cccc4c3c2c1cc4

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.