KpKP13 Protein target profile

7-cyano-7-deazaguanine synthase

Accession: KP13_20435

Gene: ANJ86622.1 queC 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GNL1
Length 233
Pocket druggability (P2Rank · AlphaFold DB model) 0.895
Functional annotation 1 EC 4 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
9.8% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
89.64 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.895
Structure A0A0H3GNL1
Pocket Pocket 1
Druggability (FPocket) 0.539
Structure A0A0H3GNL1
Pocket Pocket 15
ColabFold model
P2Rank 0.941 · Pocket 1
FPocket 0.764 · Pocket 2
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 464 / 4744 genomes with a hit
Prevalence 9.8%

Sequence

Primary amino-acid sequence viewer.

MKRAVVVFSGGQDSTTCLVQALQQYDEVHCVTFDYGQRHRAEIDVARELALKLGAVAHKVLDVTLLNELAVSSLTRDNIPVPDYQPDAEGIPNTFVPGRNILFLTLTAIYAYQVKAEAIITGVCETDFSGYPDCRDEFVKALHHAVSLGMAKDIRFETPLMWLNKAETWALADYWGQLDLVRRETLTCYNGIKGDGCGQCAACNLRANGLNQYLADKVGVMAVMQQKTGLAQA

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 4 GO

Subcellular localization

Localization
Unknown

Enzyme Commission (EC)

1

Gene Ontology (GO)

4
  • GO:0005524 Binding to ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
  • GO:0016879 Catalysis of the joining of two molecules, or two groups within a single molecule, via a carbon-nitrogen bond, with the concomitant hydrolysis of the diphosphate bond in ATP or a similar triphosphate.
  • GO:0008270 Binding to a zinc ion (Zn).
  • GO:0008616 The chemical reactions and pathways resulting in the formation of queuosines, a series of nucleosides found in position 34 of tRNA and having an additional pentenyl ring added via an NH group to the methyl group of 7-methylguanosine. The pentenyl ring may carry other substituents. The wobble nucleoside of the tRNA sequence (position 34) corresponds to the first position of the anticodon.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

16 records
Show feature table
Start End DB Term Name
3 212 CDD cd01995 ExsB
3 212 InterPro IPR018317 Queuosine biosynthesis protein QueC
4 206 NCBIfam TIGR00364 7-cyano-7-deazaguanine synthase QueC
4 206 InterPro IPR018317 Queuosine biosynthesis protein QueC
1 225 PIRSF PIRSF006293 ExsB
1 225 InterPro IPR018317 Queuosine biosynthesis protein QueC
2 217 PANTHER PTHR42914 7-CYANO-7-DEAZAGUANINE SYNTHASE
2 217 InterPro IPR018317 Queuosine biosynthesis protein QueC
3 213 Pfam PF06508 Queuosine biosynthesis protein QueC
3 213 InterPro IPR018317 Queuosine biosynthesis protein QueC
2 219 Hamap MF_01633 7-cyano-7-deazaguanine synthase [queC].
2 219 InterPro IPR018317 Queuosine biosynthesis protein QueC
1 221 FunFam G3DSA:3.40.50.620:FF:000017 7-cyano-7-deazaguanine synthase
1 214 SUPERFAMILY SSF52402 Adenine nucleotide alpha hydrolases-like
1 231 Gene3D G3DSA:3.40.50.620 HUPs
1 231 InterPro IPR014729 Rossmann-like alpha/beta/alpha sandwich fold

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.895
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.079
Likely same site as FPocket 15 2.9 Å 14 shared residues 100% of smaller site
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #15
0.539 Unusual size
Likely same site as P2Rank 2 2.9 Å 14 shared residues 100% of smaller site
Show in viewer
Surrounding area
Residue sets
UniProt: Binding site:188-188
UniProt: Binding site:197-197
UniProt: Binding site:200-200
UniProt: Binding site:203-203
UniProt: Binding site:8-18
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GNL1
AlphaFold DB full sequence Viewing
ColabFold KP13_20435
ColabFold full sequence Loaded

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.