KpKP13 Protein target profile

6,7-dimethyl-8-ribityllumazine synthase

Accession: KP13_02045

Gene: AHE46048.1 ribH 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GJ29
Length 156
Pocket druggability (P2Rank · AlphaFold DB model) 0.204
Direct ligand evidence 0 58 total records
Functional annotation 1 EC 4 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
24.1% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
100.0 Higher values support similarity to known essential genes.
DEG E-value
9.180000000000001e-110 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
98.07 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.204
Structure A0A0H3GJ29
Pocket Pocket 1
Druggability (FPocket) 0.681
Structure A0A0H3GJ29
Pocket Pocket 1
ColabFold model
P2Rank 0.259 · Pocket 1
FPocket 0.513 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 1145 / 4744 genomes with a hit
Prevalence 24.1%

Sequence

Primary amino-acid sequence viewer.

MNIIEANVATPDARVAITIARFNNFINDSLLEGAIDALKRIGQVKDENITVVWVPGAYELPLAAGALAKTGKYDAVIALGTVIRGGTAHFEYVAGGASNGLAHVAQDSEIPVAFGVLTTESIEQAIERAGTKAGNKGAEAALTALEMINVLKAIKA

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 4 GO

Subcellular localization

Localization
Cytoplasmic

Enzyme Commission (EC)

1

Gene Ontology (GO)

4
  • GO:0009231 The chemical reactions and pathways resulting in the formation of riboflavin (vitamin B2), the precursor for the coenzymes flavin mononucleotide (FMN) and flavin adenine dinucleotide (FAD).
  • GO:0000906 Catalysis of the reaction: 3,4-dihydroxy-2-butanone-4-phosphate + 5-amino-6-ribitylamino-2,4(1H,3H)-pyrimidinedione = 6,7-dimethyl-8-ribityllumazine + phosphate.
  • GO:0009349 An flavoprotein that catalyzes the reaction the breakdown of dimethyl(ribityl)lumazine to form riboflavin and ribitylamino-amino-dihydroxypyrimidine.
  • GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

15 records
Show feature table
Start End DB Term Name
15 148 CDD cd09209 Lumazine_synthase-I
15 148 InterPro IPR034964 Lumazine synthase
14 150 NCBIfam TIGR00114 6,7-dimethyl-8-ribityllumazine synthase
14 150 InterPro IPR034964 Lumazine synthase
1 156 FunFam G3DSA:3.40.50.960:FF:000001 6,7-dimethyl-8-ribityllumazine synthase
4 154 SUPERFAMILY SSF52121 Lumazine synthase
4 154 InterPro IPR036467 Lumazine/riboflavin synthase superfamily
9 155 PANTHER PTHR21058 6,7-DIMETHYL-8-RIBITYLLUMAZINE SYNTHASE DMRL SYNTHASE LUMAZINE SYNTHASE
9 155 InterPro IPR034964 Lumazine synthase
1 156 Gene3D G3DSA:3.40.50.960 Lumazine/riboflavin synthase
1 156 InterPro IPR036467 Lumazine/riboflavin synthase superfamily
8 154 Hamap MF_00178 6,7-dimethyl-8-ribityllumazine synthase [ribH].
8 154 InterPro IPR034964 Lumazine synthase
13 151 Pfam PF00885 6,7-dimethyl-8-ribityllumazine synthase
13 151 InterPro IPR002180 Lumazine/riboflavin synthase

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.204
Likely same site as FPocket 1 3.2 Å 11 shared residues 100% of smaller site
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #1
0.681 Unusual size
Likely same site as P2Rank 1 3.2 Å 11 shared residues 100% of smaller site
Show in viewer
Surrounding area
Residue sets
UniProt: Active site:89-89 Proton donor
UniProt: Binding site:114-114
UniProt: Binding site:128-128
UniProt: Binding site:22-22
UniProt: Binding site:57-59
UniProt: Binding site:81-83
UniProt: Binding site:86-87
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GJ29
AlphaFold DB full sequence Viewing
ColabFold KP13_02045
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

58 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 8 records from similar proteins
Structural ligands 8 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
5YL PDB via homolog 411.3 Da · LogP -2.56 · TPSA 216.2 Open detail RCSB PDB
CRM PDB via homolog Detail RCSB PDB
DLZ PDB via homolog Detail RCSB PDB
INI PDB via homolog Detail RCSB PDB
LMZ PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
5YL RCSB PDB O66529 411.3 Da LogP -2.56 TPSA 216.2 1 viol. ✓ Clean C(CCC1=C(NC(=O)NC1=O)NC[C@@H]([C@@H]([C@@H](CO)…
CRM RCSB PDB Q9UUB1 386.3 Da LogP -4.13 TPSA 218.8 1 viol. ✓ Clean C(CC(=O)O)C1=NC2=C(NC(=O)NC2=O)N(C1=O)C[C@@H]([…
DLZ RCSB PDB Q6FXA8 326.3 Da LogP -2.88 TPSA 161.6 ✓ Ro5 ✓ Clean CC1=C(N(C2=NC(=O)NC(=O)C2=N1)C[C@@H]([C@@H]([C@…
INI RCSB PDB P11998 306.2 Da LogP -3.54 TPSA 201.8 1 viol. ✓ Clean C([C@@H]([C@@H]([C@@H](CO)O)O)O)NC1=C(C(=O)NC(=…
LMZ RCSB PDB O66529 290.2 Da LogP -3.05 TPSA 188.1 1 viol. ✓ Clean C([C@@H]([C@@H]([C@@H](CO)O)O)O)NC1=C(C(=O)NC(=…
RBF RCSB PDB Q9UUB1 376.4 Da LogP -1.72 TPSA 161.6 ✓ Ro5 ✓ Clean Cc1cc2c(cc1C)N(C3=NC(=O)NC(=O)C3=N2)C[C@@H]([C@…
RDL RCSB PDB O66529 330.3 Da LogP -4.86 TPSA 201.5 1 viol. ✓ Clean C([C@@H]([C@@H]([C@@H](CO)O)O)O)N1C2=C(C(=O)NC(…
RLP RCSB PDB O66529 386.3 Da LogP -3.77 TPSA 219.1 2 viol. ✓ Clean C(CC(=O)O)C1=C(N(C2=NC(=O)NC(=O)C2=N1)C[C@@H]([…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.