KpKP13 Protein target profile

Fructose-bisphosphate aldolase

Accession: KP13_02064

Gene: AHE46067.1 fba 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GJ12
Length 288
Pocket druggability (P2Rank · AlphaFold DB model) 0.16
Direct ligand evidence 0 10 total records
Functional annotation 0 EC 6 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
3.0% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
51.408 Higher values support similarity to known essential genes.
DEG E-value
1.51e-102 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
94.46 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.16
Structure A0A0H3GJ12
Pocket Pocket 1
Druggability (FPocket) 0.946
Structure A0A0H3GJ12
Pocket Pocket 1
ColabFold model
P2Rank 0.068 · Pocket 1
FPocket 0.57 · Pocket 6
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 143 / 4744 genomes with a hit
Prevalence 3.0%

Sequence

Primary amino-acid sequence viewer.

MNMLVSMKDMLQHALRDGYAVGQFNINNLEWVGAVLSTAQQCRSPVILGVSGGTVKHMLGLKCIHDIVVNAMEYLHIDVPVALHLDHGTSREACEAAIAAGFSSIMFDGSHLPFRENLAITRHLVTLAHSKGISVEAELGTIAGSEDGIVNSEVIYADPQECYTLVTETQVDCLAAALGSTHGLYKGKARLGFTEMKAIAEQVKVPLVLHGGTGIADEDMRRAIACGTAKINVNTENMYAWCQQVKAIFAADTGHDVNDPRKVIAQGLQPVREMIARRMALFGSEQRY

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

6 GO

Subcellular localization

Localization
Cytoplasmic

Gene Ontology (GO)

6
  • GO:0030388 The chemical reactions and pathways involving fructose 1,6-bisphosphate, also known as FBP. The D enantiomer is a metabolic intermediate in glycolysis and gluconeogenesis.
  • GO:0008270 Binding to a zinc ion (Zn).
  • GO:0005975 The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y.
  • GO:0016832 Catalysis of the cleavage of a C-C bond in a molecule containing a hydroxyl group and a carbonyl group to form two smaller molecules, each being an aldehyde or a ketone.
  • GO:0004332 Catalysis of the reaction: beta-D-fructose 1,6-bisphosphate = D-glyceraldehyde 3-phosphate + dihydroxyacetone phosphate.
  • GO:0006096 The chemical reactions and pathways resulting in the breakdown of a carbohydrate into pyruvate, with the concomitant production of a small amount of ATP and the reduction of NAD(P) to NAD(P)H. Glycolysis begins with the metabolism of a carbohydrate to generate products that can enter the pathway and ends with the production of pyruvate. Pyruvate may be converted to acetyl-coenzyme A, ethanol, lactate, or other small molecules.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

14 records
Show feature table
Start End DB Term Name
7 285 CDD cd00947 TBP_aldolase_IIB
7 285 InterPro IPR000771 Fructose-bisphosphate aldolase, class-II
4 287 NCBIfam TIGR01859 class II fructose-1,6-bisphosphate aldolase
4 287 InterPro IPR011289 Fructose-1,6-bisphosphate aldolase, class 2
2 288 PIRSF PIRSF001359 F_bP_aldolase_II
2 288 InterPro IPR000771 Fructose-bisphosphate aldolase, class-II
1 287 Gene3D G3DSA:3.20.20.70 Aldolase class I
1 287 InterPro IPR013785 Aldolase-type TIM barrel
2 284 PANTHER PTHR30304 D-TAGATOSE-1,6-BISPHOSPHATE ALDOLASE
3 287 NCBIfam TIGR00167 ketose-bisphosphate aldolase
3 287 InterPro IPR000771 Fructose-bisphosphate aldolase, class-II
5 286 Pfam PF01116 Fructose-bisphosphate aldolase class-II
5 286 InterPro IPR000771 Fructose-bisphosphate aldolase, class-II
5 285 SUPERFAMILY SSF51569 Aldolase

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.16
Likely same site as FPocket 1 6.1 Å 7 shared residues 64% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.123
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.068
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.06
Likely same site as FPocket 1 6.3 Å 8 shared residues 89% of smaller site
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.057
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #1
0.946
Likely same site as P2Rank 1 6.1 Å 7 shared residues 64% of smaller site
Show in viewer
Surrounding area
Pocket 2 FPocket #5
0.389
Show in viewer
Surrounding area
Residue sets
UniProt: Active site:82-82 Proton donor
UniProt: Binding site:104-104
UniProt: Binding site:134-134
UniProt: Binding site:178-178
UniProt: Binding site:179-179
UniProt: Binding site:206-206
UniProt: Binding site:207-209
UniProt: Binding site:228-231
UniProt: Binding site:83-83
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GJ12
AlphaFold DB full sequence Viewing
ColabFold KP13_02064
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

10 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 4 records from similar proteins
Structural ligands 4 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 6 similarity-based ZINC candidates
Best available ligand signal
13P PDB via homolog 170.1 Da · LogP -1.34 · TPSA 104.1 Open detail RCSB PDB
FLC PDB via homolog Detail RCSB PDB
MLT PDB via homolog Detail RCSB PDB
PGH PDB via homolog Detail RCSB PDB
ZINC71773889 ZINC proposed compound · Tanimoto 0.667 Detail ZINC

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
13P RCSB PDB A0A6H3AA11 170.1 Da LogP -1.34 TPSA 104.1 ✓ Ro5 ✓ Clean C(C(=O)COP(=O)(O)O)O
FLC RCSB PDB W8TRN9 189.1 Da LogP -5.25 TPSA 140.6 ✓ Ro5 ✓ Clean C(C(=O)[O-])C(CC(=O)[O-])(C(=O)[O-])O
MLT RCSB PDB Q6TV43 134.1 Da LogP -1.09 TPSA 94.8 ✓ Ro5 ✓ Clean C([C@H](C(=O)O)O)C(=O)O
PGH RCSB PDB P0AB74 171.0 Da LogP -1.40 TPSA 116.1 ✓ Ro5 ✓ Clean C(C(=O)NO)OP(=O)(O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.