KpKP13 Protein target profile

2,5-diketo-D-gluconic acid reductase B

Accession: KP13_02944

Gene: dkgB AHE46216.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GN15
Length 267
Pocket druggability (P2Rank · AlphaFold DB model) 0.92
Direct ligand evidence 0 54 total records
Functional annotation 0 EC 4 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
45.455 Lower values reduce human off-target concern.
Human E-value
3.11e-10
Gut microbiome similarity
2.2% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
97.89 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.92
Structure A0A0H3GN15
Pocket Pocket 1
Druggability (FPocket) 0.46
Structure A0A0H3GN15
Pocket Pocket 1
ColabFold model
P2Rank 0.906 · Pocket 1
FPocket 0.567 · Pocket 2
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 103 / 4744 genomes with a hit
Prevalence 2.2%

Sequence

Primary amino-acid sequence viewer.

MAIPAFGLGTFRLKDDVVIASVKTALELGYRAIDTAQIYDNEAAVGQAIAESGVPRDELFITTKIWIENLSKDKLIASLQESLQKLRTDYVDLTLIHWPAPNDAVAVEEFMAALMEAKKLGLTRQIGISNFTIPLMERAIAAVGAENIATNQIELSPYLQNRKVVDWAREHGIHITSYMTLAYGKALKDEVIARIAAKHNATPAQVILAWAMGEGYAVIPSSTKRDNLASNLKALDLQLDDEDRQAIAALDCNDRLVSPEGLAPQWD

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

4 GO

Subcellular localization

Localization
Cytoplasmic

Gene Ontology (GO)

4
  • GO:0016491 Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
  • GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
  • GO:1990002 Catalysis of the reaction: hydroxyacetone + NADP+ = H+ + methylglyoxal + NADPH.
  • GO:0051596 The chemical reactions and pathways resulting in the breakdown of methylglyoxal, CH3-CO-CHO, the aldehyde of pyruvic acid.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

27 records
Show feature table
Start End DB Term Name
81 99 PRINTS PR00069 Aldo-keto reductase signature
81 99 InterPro IPR020471 Aldo-keto reductase
149 178 PRINTS PR00069 Aldo-keto reductase signature
149 178 InterPro IPR020471 Aldo-keto reductase
186 210 PRINTS PR00069 Aldo-keto reductase signature
186 210 InterPro IPR020471 Aldo-keto reductase
114 131 PRINTS PR00069 Aldo-keto reductase signature
114 131 InterPro IPR020471 Aldo-keto reductase
25 49 PRINTS PR00069 Aldo-keto reductase signature
25 49 InterPro IPR020471 Aldo-keto reductase
1 265 PIRSF PIRSF000097 AKR
1 265 InterPro IPR020471 Aldo-keto reductase
225 245 Coils Coil Coil
3 250 CDD cd19139 AKR_AKR3F2
29 46 ProSitePatterns PS00798 Aldo/keto reductase family signature 1.
29 46 InterPro IPR018170 Aldo/keto reductase, conserved site
1 265 FunFam G3DSA:3.20.20.100:FF:000016 2,5-diketo-D-gluconic acid reductase B
1 266 Gene3D G3DSA:3.20.20.100 -
1 266 InterPro IPR036812 NADP-dependent oxidoreductase domain superfamily
12 250 Pfam PF00248 Aldo/keto reductase family
12 250 InterPro IPR023210 NADP-dependent oxidoreductase domain
114 131 ProSitePatterns PS00062 Aldo/keto reductase family signature 2.
114 131 InterPro IPR018170 Aldo/keto reductase, conserved site
2 257 PANTHER PTHR43827 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE
2 257 InterPro IPR020471 Aldo-keto reductase
2 257 SUPERFAMILY SSF51430 NAD(P)-linked oxidoreductase
2 257 InterPro IPR036812 NADP-dependent oxidoreductase domain superfamily

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.92
Likely same site as FPocket 1 1.2 Å 23 shared residues 92% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.03
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #1
0.46 Unusual size
Likely same site as P2Rank 1 1.2 Å 23 shared residues 92% of smaller site
Show in viewer
Surrounding area
Residue sets
UniProt: Active site:39-39 Proton donor
UniProt: Binding site:97-97
UniProt: Site:64-64 Lowers pKa of active site Tyr
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GN15
AlphaFold DB full sequence Viewing
ColabFold KP13_02944
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

54 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 4 records from similar proteins
Structural ligands 4 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
EPR PDB via homolog 319.4 Da · LogP 2.92 · TPSA 57.6 Open detail RCSB PDB
MLI PDB via homolog Detail RCSB PDB
NA7 PDB via homolog Detail RCSB PDB
TOL PDB via homolog Detail RCSB PDB
ZINC13507152 ZINC proposed compound · Tanimoto 1.000 Detail ZINC

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
EPR RCSB PDB Q9X265 319.4 Da LogP 2.92 TPSA 57.6 ✓ Ro5 Alert C/C(=C\c1ccccc1)/C=C2C(=O)N(C(=S)S2)CC(=O)O
MLI RCSB PDB P9WQA5 102.0 Da LogP -3.12 TPSA 80.3 ✓ Ro5 ✓ Clean C(C(=O)[O-])C(=O)[O-]
NA7 RCSB PDB A0QV09 623.3 Da LogP -2.48 TPSA 317.8 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
TOL RCSB PDB Q9X265 357.4 Da LogP 3.56 TPSA 49.8 ✓ Ro5 ✓ Clean CN(CC(=O)O)C(=S)c1cccc2c1ccc(c2C(F)(F)F)OC

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.