KpKP13 Protein target profile

Ribosome-recycling factor

Accession: KP13_01808

Gene: AHE46248.1 frr 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GNJ3

Export view

Length 185

Pocket druggability (P2Rank · AlphaFold DB model) 0.036

Direct ligand evidence 0 51 total records

Functional annotation 0 EC 4 GO

Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target: Hit
Human identity (%): 32.184 Lower values reduce human off-target concern.
Human E-value: 6.47e-19
Gut microbiome similarity: 13.4% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG): Y
DEG identity (%): 95.135 Higher values support similarity to known essential genes.
DEG E-value: 3.41e-127 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT: 86.39 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.036

Structure A0A0H3GNJ3

Pocket Pocket 1

Druggability (FPocket) 0.195

Structure A0A0H3GNJ3

Pocket Pocket 1

ColabFold model

FPocket 0.64 · Pocket 4

Core conservation Conserved core gene

Roary core

CoreCruncher core

Gut microbiome 638 / 4744 genomes with a hit

Prevalence 13.4%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

UniProt A0A0H3GNJ3

Sequence

Primary amino-acid sequence viewer.

MISDIRKDAEIRMEKCVEAFKNQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVFDRSMSAAVEKAIMASDLGLNPSSAGSDIRVPLPPLTEERRKDLTKIVRGEAEQARVAVRNVRRDANDKVKALLKEKEISEDDDRRSQDDVQKMTDAAIKKVDAALADKEAELMQF

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

4 GO

Subcellular localization

Localization: Cytoplasmic

Gene Ontology (GO)

GO:0006412 The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
GO:0043023 Binding to a large ribosomal subunit.
GO:0002184 The process resulting in the release of a polypeptide chain from the ribosome in the cytoplasm, usually in response to a termination codon.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

19 records

Show feature table

Start	End	DB	Term	Name
3	185	Hamap	MF_00040	Ribosome-recycling factor [frr].
3	185	InterPro	IPR002661	Ribosome recycling factor
31	105	Gene3D	G3DSA:3.30.1360.40	-
20	183	Pfam	PF01765	Ribosome recycling factor
20	183	InterPro	IPR023584	Ribosome recycling factor domain
31	105	FunFam	G3DSA:3.30.1360.40:FF:000001	Ribosome-recycling factor
1	184	SUPERFAMILY	SSF55194	Ribosome recycling factor, RRF
1	184	InterPro	IPR036191	RRF superfamily
12	182	Gene3D	G3DSA:1.10.132.20	-
12	182	InterPro	IPR036191	RRF superfamily
145	164	MobiDBLite	mobidb-lite	consensus disorder prediction
96	182	FunFam	G3DSA:1.10.132.20:FF:000001	Ribosome-recycling factor
5	183	CDD	cd00520	RRF
5	183	InterPro	IPR002661	Ribosome recycling factor
12	185	NCBIfam	TIGR00496	ribosome recycling factor
12	185	InterPro	IPR002661	Ribosome recycling factor
4	184	PANTHER	PTHR20982	RIBOSOME RECYCLING FACTOR
4	184	InterPro	IPR002661	Ribosome recycling factor
132	152	Coils	Coil	Coil

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low

How colors and pocket overlays are used

Uniform protein color marks the displayed model as a single molecular object.

Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.

Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.

'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.

'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.

'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.

Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1

0.036

Show in viewer

Surrounding area

All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold DB AF_A0A0H3GNJ3	AlphaFold DB	—	—	full sequence	—	Viewing
ColabFold KP13_01808	ColabFold	—	—	full sequence	—	Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

51 records

Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records

Transferred evidence 1 records from similar proteins

Structural ligands 1 0 loaded crystals

Measured bioactivity 0 direct and transferred ChEMBL records

Proposed compounds 50 similarity-based ZINC candidates

Best available ligand signal

DEM PDB via homolog 188.3 Da · LogP 3.09 · TPSA 29.5 Open detail RCSB PDB

ZINC1627284 ZINC proposed compound · Tanimoto 0.684 Detail ZINC

ZINC2564179 ZINC proposed compound · Tanimoto 0.684 Detail ZINC

ZINC1849711 ZINC proposed compound · Tanimoto 0.682 Detail ZINC

ZINC1850542 ZINC proposed compound · Tanimoto 0.682 Detail ZINC

Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.

No PDB structure with a co-crystallized ligand found for this exact protein.

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Ligand	Source crystal	UniProt (homolog)	MW · LogP · TPSA	Lipinski	PAINS	SMILES
DEM RCSB PDB	1EK8	P0A805	188.3 Da LogP 3.09 TPSA 29.5	✓ Ro5	✓ Clean	`CCCCCCCCCCOCO`

Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).

No ChEMBL bioactivity data found for this exact protein.

Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).

No ChEMBL hits found through similar proteins.

Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).

Ligand	Tanimoto	MW · LogP · TPSA	Lipinski	PAINS	SMILES
ZINC1627284 ZINC	0.684	214.4 Da LogP 4.94 TPSA 9.2	✓ Ro5	✓ Clean	`CCCCCCCOCCCCCCC`
ZINC2564179 ZINC	0.684	214.4 Da LogP 4.94 TPSA 9.2	✓ Ro5	✓ Clean	`CCCCCCCCOCCCCCC`
ZINC1849711 ZINC	0.682	202.3 Da LogP 3.14 TPSA 29.5	✓ Ro5	✓ Clean	`CCCCCCCCCCOCCO`
ZINC1850542 ZINC	0.682	216.4 Da LogP 3.53 TPSA 29.5	✓ Ro5	✓ Clean	`CCCCCCCCCCCOCCO`
ZINC59545536 ZINC	0.682	258.4 Da LogP 4.70 TPSA 29.5	✓ Ro5	✓ Clean	`CCCCCCCCCCCCCOCCCO`
ZINC59660505 ZINC	0.682	244.4 Da LogP 4.31 TPSA 29.5	✓ Ro5	✓ Clean	`CCCCCCCCCCCCCOCCO`
ZINC8437287 ZINC	0.682	230.4 Da LogP 3.92 TPSA 29.5	✓ Ro5	✓ Clean	`CCCCCCCCCCCCOCCO`
ZINC85733754 ZINC	0.682	258.4 Da LogP 4.70 TPSA 29.5	✓ Ro5	✓ Clean	`CCCCCCCCCCCCCCOCCO`
ZINC95831576 ZINC	0.682	230.4 Da LogP 3.92 TPSA 29.5	✓ Ro5	✓ Clean	`CCCCCCCCCCOCCCCO`
ZINC100014200 ZINC	0.652	494.7 Da LogP 4.02 TPSA 84.8	✓ Ro5	✓ Clean	`CCCCCCCCCCCCOCCOCCOCCOCCOCCOCCOCCO`
ZINC100070166 ZINC	0.652	290.4 Da LogP 3.17 TPSA 47.9	✓ Ro5	✓ Clean	`CCCCCCCCCCOCCOCCOCCO`
ZINC100310628 ZINC	0.652	478.7 Da LogP 4.78 TPSA 75.6	✓ Ro5	✓ Clean	`CCCCCCCCCCCCCCOCCOCCOCCOCCOCCOCCO`
ZINC100365196 ZINC	0.652	302.5 Da LogP 4.71 TPSA 38.7	✓ Ro5	✓ Clean	`CCCCCCCCCCCCCCOCCOCCO`
ZINC101772322 ZINC	0.652	434.7 Da LogP 4.76 TPSA 66.4	✓ Ro5	✓ Clean	`CCCCCCCCCCCCCCOCCOCCOCCOCCOCCO`
ZINC103600921 ZINC	0.652	466.7 Da LogP 3.24 TPSA 84.8	✓ Ro5	✓ Clean	`CCCCCCCCCCOCCOCCOCCOCCOCCOCCOCCO`
ZINC14880431 ZINC	0.652	378.6 Da LogP 3.20 TPSA 66.4	✓ Ro5	✓ Clean	`CCCCCCCCCCOCCOCCOCCOCCOCCO`
ZINC14881140 ZINC	0.652	306.4 Da LogP 2.41 TPSA 57.2	✓ Ro5	✓ Clean	`CCCCCCCCOCCOCCOCCOCCO`
ZINC16051619 ZINC	0.652	350.5 Da LogP 2.42 TPSA 66.4	✓ Ro5	✓ Clean	`CCCCCCCCOCCOCCOCCOCCOCCO`
ZINC2584424 ZINC	0.652	218.3 Da LogP 2.37 TPSA 38.7	✓ Ro5	✓ Clean	`CCCCCCCCOCCOCCO`
ZINC4521877 ZINC	0.652	234.3 Da LogP 1.61 TPSA 47.9	✓ Ro5	✓ Clean	`CCCCCCOCCOCCOCCO`
ZINC5273610 ZINC	0.652	322.4 Da LogP 1.64 TPSA 66.4	✓ Ro5	✓ Clean	`CCCCCCOCCOCCOCCOCCOCCO`
ZINC58538366 ZINC	0.652	392.6 Da LogP 3.59 TPSA 66.4	✓ Ro5	✓ Clean	`CCCCCCCCCCCOCCOCCOCCOCCOCCO`
ZINC58631420 ZINC	0.652	422.6 Da LogP 3.22 TPSA 75.6	✓ Ro5	✓ Clean	`CCCCCCCCCCOCCOCCOCCOCCOCCOCCO`
ZINC59441819 ZINC	0.652	318.5 Da LogP 3.95 TPSA 47.9	✓ Ro5	✓ Clean	`CCCCCCCCCCCCOCCOCCOCCO`
ZINC59622400 ZINC	0.652	274.4 Da LogP 3.93 TPSA 38.7	✓ Ro5	✓ Clean	`CCCCCCCCCCCCOCCOCCO`
ZINC71788551 ZINC	0.652	334.5 Da LogP 3.19 TPSA 57.2	✓ Ro5	✓ Clean	`CCCCCCCCCCOCCOCCOCCOCCO`
ZINC71788564 ZINC	0.652	262.4 Da LogP 2.39 TPSA 47.9	✓ Ro5	✓ Clean	`CCCCCCCCOCCOCCOCCO`
ZINC71788567 ZINC	0.652	406.6 Da LogP 3.98 TPSA 66.4	✓ Ro5	✓ Clean	`CCCCCCCCCCCCOCCOCCOCCOCCOCCO`
ZINC8214594 ZINC	0.652	362.6 Da LogP 3.97 TPSA 57.2	✓ Ro5	✓ Clean	`CCCCCCCCCCCCOCCOCCOCCOCCO`
ZINC88260008 ZINC	0.652	390.6 Da LogP 4.75 TPSA 57.2	✓ Ro5	✓ Clean	`CCCCCCCCCCCCCCOCCOCCOCCOCCO`
ZINC95784968 ZINC	0.652	450.7 Da LogP 4.00 TPSA 75.6	✓ Ro5	✓ Clean	`CCCCCCCCCCCCOCCOCCOCCOCCOCCOCCO`
ZINC95863931 ZINC	0.652	464.7 Da LogP 4.39 TPSA 75.6	✓ Ro5	✓ Clean	`CCCCCCCCCCCCCOCCOCCOCCOCCOCCOCCO`
ZINC1697133 ZINC	0.619	214.4 Da LogP 4.94 TPSA 9.2	✓ Ro5	✓ Clean	`CCCCCCCCCCCCOCC`
ZINC2555269 ZINC	0.609	220.3 Da LogP 1.22 TPSA 47.9	✓ Ro5	✓ Clean	`CCCCCOCCOCCOCCO`
ZINC43393602 ZINC	0.560	316.5 Da LogP 4.84 TPSA 49.7	✓ Ro5	✓ Clean	`CCCCCCCCCCCCCCCCOC(CO)CO`
ZINC14236469 ZINC	0.556	260.4 Da LogP 3.28 TPSA 49.7	✓ Ro5	✓ Clean	`CCCCCCCCCCCCOC[C@@H](O)CO`
ZINC1618164 ZINC	0.556	204.3 Da LogP 1.72 TPSA 49.7	✓ Ro5	✓ Clean	`CCCCCCCCOC[C@H](O)CO`
ZINC2027052 ZINC	0.556	232.4 Da LogP 2.50 TPSA 49.7	✓ Ro5	✓ Clean	`CCCCCCCCCCOC[C@H](O)CO`
ZINC2027055 ZINC	0.556	232.4 Da LogP 2.50 TPSA 49.7	✓ Ro5	✓ Clean	`CCCCCCCCCCOC[C@@H](O)CO`
ZINC2555645 ZINC	0.556	218.3 Da LogP 2.11 TPSA 49.7	✓ Ro5	✓ Clean	`CCCCCCCCCOC[C@H](O)CO`
ZINC28540497 ZINC	0.556	260.4 Da LogP 3.28 TPSA 49.7	✓ Ro5	✓ Clean	`CCCCCCCCCCCCOC[C@H](O)CO`
ZINC59422796 ZINC	0.556	204.3 Da LogP 1.72 TPSA 49.7	✓ Ro5	✓ Clean	`CCCCCCCCOC[C@@H](O)CO`
ZINC8437480 ZINC	0.556	316.5 Da LogP 4.84 TPSA 49.7	✓ Ro5	✓ Clean	`CCCCCCCCCCCCCCCCOC[C@H](O)CO`
ZINC8437481 ZINC	0.556	316.5 Da LogP 4.84 TPSA 49.7	✓ Ro5	✓ Clean	`CCCCCCCCCCCCCCCCOC[C@@H](O)CO`
ZINC85479878 ZINC	0.556	218.3 Da LogP 2.11 TPSA 49.7	✓ Ro5	✓ Clean	`CCCCCCCCCOC[C@@H](O)CO`
ZINC1672261 ZINC	0.542	218.4 Da LogP 4.07 TPSA 9.2	✓ Ro5	✓ Clean	`CCCCCCCCCCOCCS`
ZINC2582057 ZINC	0.542	215.4 Da LogP 3.49 TPSA 35.2	✓ Ro5	✓ Clean	`CCCCCCCCCCOCCCN`
ZINC8214595 ZINC	0.542	243.4 Da LogP 4.27 TPSA 35.2	✓ Ro5	✓ Clean	`CCCCCCCCCCCCOCCCN`
ZINC100933502 ZINC	0.538	244.4 Da LogP 4.01 TPSA 46.5	✓ Ro5	✓ Clean	`CCCCCCCCCCCCOCC(=O)O`
ZINC1566430 ZINC	0.538	230.3 Da LogP 3.62 TPSA 46.5	✓ Ro5	✓ Clean	`CCCCCCCCCCCOCC(=O)O`

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Ribosome-recycling factor

Target candidate with partial support; inspect missing evidence before prioritizing.

Main supporting evidence

Risks to review

Evidence gaps

Prioritization evidence

Off-target risk

Essentiality

Structure confidence

Binding-site evidence

Cross-references

Sequence

Sequence

Functional annotations

Subcellular localization

Gene Ontology (GO)

Sequence domains and features

3D structure

Binding pockets · P2Rank

Binding pockets · FPocket

Structural evidence

Ligand evidence