KpKP13 Protein target profile

Pullulanase

Accession: KP13_01834

Gene: pulA AHE46274.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GJK2
Length 1037
Pocket druggability (P2Rank · AlphaFold DB model) 0.818
Direct ligand evidence 0 2 total records
Functional annotation 1 EC 4 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
0.3% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
97.88 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.818
Structure A0A0H3GJK2
Pocket Pocket 1
Druggability (FPocket) 0.302
Structure A0A0H3GJK2
Pocket Pocket 10
ColabFold model
P2Rank 0.88 · Pocket 1
FPocket 0.405 · Pocket 21
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 14 / 4744 genomes with a hit
Prevalence 0.3%

Sequence

Primary amino-acid sequence viewer.

MQASARQAVIHLVDIAGITSSTPADYATKNLYLWNNETCDALSAPVADWNDVSTTPTGSDKYGPYWMIPLTKESGCINVIVRDGTNKLIDSDLRVSFSDFTDRTVSVIAGNSAVYDSRADAFRAAFGVALADAHWVDKTTLLWPGGENKPIVRLYYSHSSKVAADSNGEFSDKYVKLTPTTVSQQVIMRFPHLASYPAFKLPDDINVDELLQGETVAIAAESDGILSSATQVQTAGVLDDTYAAAAEALSYGAQLTDSGVTFRVWAPTAQQVELVIYSADKKVIASHPMTRDSASGAWSWQGGSDLKGAFYRYAMTVYHPQSRKVEQYEVTDPYAHSLSTNSEYSQVVDLNDSALKPEGWDGLTMPHAQKTKADLAKMTIHESHIRDLSAWDQTVPAELRGKYLALTAQESNMVQHLKQLSASGVTHIELLPVFDLATVNEFSDKVADIQQPFSRLCEVNSAVKSSEFAGYCDSGSTVEEVLTQLKQNDSKDNPQVQALNTLVAQTDSYNWGYDPFHYTVPEGSYATDPEGTARIKEFRTMIQAIKQDLGMNVIMDVVYNHTNAAGPTDRTSVLDKIVPWYYQRLNETTGSVESATCCSDSAPEHRMFAKLIADSLAVWTTDYKIDGFRFDLMGYHPKAQILSAWERIKALNPDIYFFGEGWDSNQSDRFEIASQINLKGTGIGTFSDRLRDAVRGGGPFDSGDALRQNQGVGSGAGVLPNELTTLTDDQARHLADLTRLGMAGNLADFVLIDKDGAVKRGSEIDYNGAPGGYAADPTEVVNYVSKHDNQTLWDMISYKAAQEADLDTRVRMQAVSLATVMLGQGIAFDQQGSELLRSKSFTRDSYDSGDWFNRVDYSLQDNNYNVGMPRSSDDGSNYDIIARVKDAVATPGETELKQMTAFYQELTALRKSSPLFTLGDGATVMKRVDFRNTGADQQTGLLVMTIDDGMQAGASLDSRVDGIVVAINAAPESRTLQDFAGTSLQLSAIQQAAGDRSLASGVQVAADGSVTLPAWSVAVLELPQGESQGAGLPVSSK

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 4 GO

Subcellular localization

Localization
Unknown

Enzyme Commission (EC)

1

Gene Ontology (GO)

4
  • GO:0030246 Binding to a carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.
  • GO:0005975 The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y.
  • GO:0004553 Catalysis of the hydrolysis of any O-glycosyl bond.
  • GO:0051060 Catalysis of the hydrolysis of (1,6)-alpha-D-glucosidic linkages in pullulan (a linear polymer of alpha-(1,6)-linked maltotriose units) and in amylopectin and glycogen, and the a- and b-limit dextrins of amylopectin and glycogen.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

35 records
Show feature table
Start End DB Term Name
127 241 Gene3D G3DSA:2.60.40.1130 -
251 353 SUPERFAMILY SSF81296 E set domains
251 353 InterPro IPR014756 Immunoglobulin E-set
6 118 CDD cd10315 CBM41_pullulanase
6 118 InterPro IPR005323 Pullulanase, carbohydrate-binding module 41
347 919 SUPERFAMILY SSF51445 (Trans)glycosidases
347 919 InterPro IPR017853 Glycoside hydrolase superfamily
184 977 PANTHER PTHR43002 GLYCOGEN DEBRANCHING ENZYME
1 117 Gene3D G3DSA:2.60.40.1110 -
929 1037 Gene3D G3DSA:2.60.40.1180 -
929 1037 InterPro IPR013780 Glycosyl hydrolase, all-beta
128 1024 NCBIfam TIGR02103 pullulanase-type alpha-1,6-glucosidase
128 1024 InterPro IPR011839 Alpha-1,6-glucosidases, pullulanase-type
860 1020 Pfam PF11852 Alpha-1,6-glucosidases, pullulanase-type, C-terminal
860 1020 InterPro IPR024561 Alpha-1,6-glucosidases, pullulanase-type, C-terminal
252 350 CDD cd02860 E_set_Pullulanase
480 799 SMART SM00642 aamy
480 799 InterPro IPR006047 Glycosyl hydrolase, family 13, catalytic domain
436 509 Pfam PF18494 Pullulanase Ins domain
436 509 InterPro IPR041111 Pullulanase, Ins domain
120 240 SUPERFAMILY SSF81296 E set domains
120 240 InterPro IPR014756 Immunoglobulin E-set
6 115 SUPERFAMILY SSF49452 Starch-binding domain-like
6 115 InterPro IPR013784 Carbohydrate-binding-like fold
350 928 Gene3D G3DSA:3.20.20.80 Glycosidases
921 1036 SUPERFAMILY SSF51011 Glycosyl hydrolase domain
24 115 Pfam PF03714 Bacterial pullanase-associated domain
24 115 InterPro IPR005323 Pullulanase, carbohydrate-binding module 41
131 240 Pfam PF17967 Pullulanase N2 domain
131 240 InterPro IPR040671 Pullulanase, N2 domain
378 866 CDD cd11341 AmyAc_Pullulanase_LD-like
251 335 Pfam PF02922 Carbohydrate-binding module 48 (Isoamylase N-terminal domain)
251 335 InterPro IPR004193 Glycoside hydrolase, family 13, N-terminal
242 349 Gene3D G3DSA:2.60.40.10 Immunoglobulins
242 349 InterPro IPR013783 Immunoglobulin-like fold

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.818
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.584
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.364
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.211
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.169
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #10
0.302
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GJK2
AlphaFold DB full sequence Viewing
ColabFold KP13_01834
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

2 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 1 records from similar proteins
Structural ligands 1 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 1 similarity-based ZINC candidates
Best available ligand signal
TAM PDB via homolog 163.2 Da · LogP -1.17 · TPSA 86.7 Open detail RCSB PDB
ZINC2575038 ZINC proposed compound · Tanimoto 0.625 Detail ZINC

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
TAM RCSB PDB A0A0C5GWS2 163.2 Da LogP -1.17 TPSA 86.7 ✓ Ro5 ✓ Clean C(CO)C(CCO)(CCO)N

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.