KpKP13 Protein target profile

putative protein transporter

Accession: KP13_01890

Gene: AHE46330.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GMN0
Length 461
Pocket druggability (P2Rank · AlphaFold DB model) 0.812
Direct ligand evidence 0 53 total records
Functional annotation 0 EC 3 GO
Target summary

Strong target candidate with converging metabolic, structural and chemical evidence.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
1.7% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
41.754 Higher values support similarity to known essential genes.
DEG E-value
5.6899999999999997e-126 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
91.02 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.812
Structure A0A0H3GMN0
Pocket Pocket 1
Druggability (FPocket) 0.81
Structure A0A0H3GMN0
Pocket Pocket 4
ColabFold model
P2Rank 0.76 · Pocket 1
FPocket 0.58 · Pocket 3
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 83 / 4744 genomes with a hit
Prevalence 1.7%

Sequence

Primary amino-acid sequence viewer.

MKTEQLIPLCRRYHAMLLHSDEQTISIAVVNTPPAELMEALRFATQKRIDIECWSQEQMDKRLQAQEKQAQLAQNDGPENIAERVNQILEQALRQRASDIHIEPTETHLRIRLRVDGVLHALPLLAPELAAPVIARLKVLASLDIAEHRLPQDGQFALNLAGRPLSFRIATLPCRYGEKIVLRLLHQVDQALDLEALGLSSSQLAAFRQALNQPQGLLLVTGPTGSGKTVTLYSALQARNREQVNICSVEDPLEIPIAGMNQTQINPRAGLTFHSVLRALLRQDPDIVMVGEIRDAETAEIALKAAQTGHLVLSTLHTNSTSETLTRLQQMGIARWMISSALSLVIAQRLVRKLCPHCRRNAGSAADLPHSLWPRPLPRWQAAGCEHCYHGYYGRLALFEVLPVTPGLRQGIVQGLNAIEIESLARAAGMMTLFESGCQAIEQGLTSLEEVVRVLGIPHGD

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Subcellular localization

Localization
Cytoplasmic

Gene Ontology (GO)

3
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
  • GO:0005524 Binding to ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
  • GO:0016887 Catalysis of the reaction: ATP + H2O = ADP + H+ phosphate. ATP hydrolysis is used in some reactions as an energy source, for example to catalyze a reaction or drive transport against a concentration gradient.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

16 records
Show feature table
Start End DB Term Name
333 351 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
21 455 PANTHER PTHR30258 TYPE II SECRETION SYSTEM PROTEIN GSPE-RELATED
72 454 SUPERFAMILY SSF52540 P-loop containing nucleoside triphosphate hydrolases
72 454 InterPro IPR027417 P-loop containing nucleoside triphosphate hydrolase
56 76 Coils Coil Coil
205 353 CDD cd01129 PulE-GspE-like
281 295 ProSitePatterns PS00662 Bacterial type II secretion system protein E signature.
281 295 InterPro IPR001482 Type II/IV secretion system domain
50 185 Gene3D G3DSA:3.30.450.90 -
87 353 Pfam PF00437 Type II/IV secretion system protein
87 353 InterPro IPR001482 Type II/IV secretion system domain
1 332 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
352 461 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
186 456 Gene3D G3DSA:3.40.50.300 -
186 456 InterPro IPR027417 P-loop containing nucleoside triphosphate hydrolase
186 456 FunFam G3DSA:3.40.50.300:FF:000398 Type IV pilus assembly ATPase PilB

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.812
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.28
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.122
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.014
Likely same site as FPocket 24 1.5 Å 9 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.012
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #4
0.81
Show in viewer
Surrounding area
Pocket 2 FPocket #1
0.525
Show in viewer
Surrounding area
Pocket 3 FPocket #2
0.22
Show in viewer
Surrounding area
Pocket 4 FPocket #24
0.2
Likely same site as P2Rank 4 1.5 Å 9 shared residues 100% of smaller site
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GMN0
AlphaFold DB full sequence Viewing
ColabFold KP13_01890
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

53 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 3 records from similar proteins
Structural ligands 3 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
ACP PDB via homolog 505.2 Da · LogP -1.52 · TPSA 269.9 Open detail RCSB PDB
AGS PDB via homolog Detail RCSB PDB
ANP PDB via homolog Detail RCSB PDB
ZINC3873854 ZINC proposed compound · Tanimoto 0.873 Detail ZINC
ZINC12360002 ZINC proposed compound · Tanimoto 0.810 Detail ZINC

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
ACP RCSB PDB P24559 505.2 Da LogP -1.52 TPSA 269.9 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
AGS RCSB PDB Q5SLC9 523.2 Da LogP -1.51 TPSA 262.1 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
ANP RCSB PDB P37093 506.2 Da LogP -2.06 TPSA 281.9 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.