Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 2.3% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 45.385 Higher values support similarity to known essential genes.
- DEG E-value
- 1.28e-36 Smaller values mean stronger essential-gene similarity.
Structure confidence
- ColabFold pLDDT
- 91.41 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
PDB experimental structureP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MKKLQIAVGIIRNPQGEIFITQRAADAHMANKLEFPGGKIESDETPEQALIRELQEEVGITVTASSLFDKLEYQFPDRHITLWFFLVESWQGEPWGKEGQPGRWMAGPTLDPAAFPPANEPVISKLIAQG
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Unknown
Enzyme Commission (EC)
1Gene Ontology (GO)
8- GO:0008413 Catalysis of the reaction: 8-oxo-7,8-dihydroguanosine triphosphate (8-oxo-GTP) + H2O = 8-oxo-7,8-dihydroguanosine diphosphate (8-oxo-GDP) + phosphate. 8-oxo-7,8-dihydroguanosine triphosphate (8-oxo-GTP) is the oxidised form of the free guanine nucleotide and can act as a potent mutagenic substrate for transcription.
- GO:0016787 Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc.
- GO:0006281 The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
- GO:0035539 Catalysis of the reaction: 8-oxo-7,8-dihydrodeoxyguanosine-triphosphate (8-oxo-dGTP) + H2O = 8-oxo-7,8-dihydrodeoxyguanosine phosphate (8-oxo-dGMP) + diphosphate. 8-oxo-dGTP is the oxidised form of the free guanine nucleotide and can act as a potent mutagenic substrate for DNA synthesis causing transversion mutations. 8-oxo-dGTPase hydrolyses 8-oxo-dGTP to its monophosphate form to prevent the misincorporation of 8-oxo-dGTP into cellular DNA.
- GO:0044715 Catalysis of the reaction 8-oxo-dGDP + H2O = 8-oxo-dGMP + phosphate.
- GO:0044716 Catalysis of the reaction 8-oxo-GDP + H2O = 8-oxo-GMP + phosphate.
- GO:0046872 Binding to a metal ion.
- GO:0006260 The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by the origin recognition complex, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 1 | 128 | Gene3D | G3DSA:3.90.79.10 | Nucleoside Triphosphate Pyrophosphohydrolase |
| 33 | 47 | PRINTS | PR00502 | NUDIX hydrolase family signature |
| 33 | 47 | InterPro | IPR020476 | NUDIX hydrolase |
| 47 | 62 | PRINTS | PR00502 | NUDIX hydrolase family signature |
| 47 | 62 | InterPro | IPR020476 | NUDIX hydrolase |
| 1 | 129 | ProSiteProfiles | PS51462 | Nudix hydrolase domain profile. |
| 1 | 129 | InterPro | IPR000086 | NUDIX hydrolase domain |
| 77 | 90 | PRINTS | PR01401 | Mutator MutT protein signature |
| 77 | 90 | InterPro | IPR003561 | Mutator MutT |
| 2 | 23 | PRINTS | PR01401 | Mutator MutT protein signature |
| 2 | 23 | InterPro | IPR003561 | Mutator MutT |
| 6 | 122 | Pfam | PF00293 | NUDIX domain |
| 6 | 122 | InterPro | IPR000086 | NUDIX hydrolase domain |
| 1 | 129 | FunFam | G3DSA:3.90.79.10:FF:000014 | 8-oxo-dGTP diphosphatase MutT |
| 4 | 127 | CDD | cd03425 | MutT_pyrophosphohydrolase |
| 2 | 128 | PANTHER | PTHR47707 | 8-OXO-DGTP DIPHOSPHATASE |
| 2 | 128 | InterPro | IPR047127 | Mutator MutT-like |
| 1 | 126 | NCBIfam | TIGR00586 | 8-oxo-dGTP diphosphatase MutT |
| 1 | 126 | InterPro | IPR003561 | Mutator MutT |
| 2 | 126 | SUPERFAMILY | SSF55811 | Nudix |
| 2 | 126 | InterPro | IPR015797 | NUDIX hydrolase-like domain superfamily |
| 38 | 59 | ProSitePatterns | PS00893 | Nudix box signature. |
| 38 | 59 | InterPro | IPR020084 | NUDIX hydrolase, conserved site |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
1 + 1Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 523 RCSB PDB | A0R2K6 | 482.2 Da LogP -1.46 TPSA 252.0 | 1 viol. | ✓ Clean |
CC1=C(NC(=O)[N+](=C1)[C@H]2C[C@@H]([C@H](O2)CO[…
|
|
| 8OG RCSB PDB | P08337 | 363.2 Da LogP -2.25 TPSA 205.8 | 1 viol. | ✓ Clean |
C1[C@@H]([C@H](O[C@H]1N2C3=C(C(=O)NC(=N3)N)NC2=…
|
|
| 9L3 RCSB PDB | A0R2K6 | 306.2 Da LogP -0.98 TPSA 139.0 | ✓ Ro5 | ✓ Clean |
Cc1c[n+](cnc1N)[C@H]2C[C@@H]([C@H](O2)COP(=O)(O…
|
|
| APC RCSB PDB | P08337 | 505.2 Da LogP -1.52 TPSA 269.9 | 3 viol. | ✓ Clean |
c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
|
|
| DCP RCSB PDB | A0R2K6 | 467.2 Da LogP -1.18 TPSA 250.2 | 2 viol. | ✓ Clean |
C1[C@@H]([C@H](O[C@H]1N2C=CC(=NC2=O)N)CO[P@@](=…
|
|
| TLA RCSB PDB | P08337 | 150.1 Da LogP -2.12 TPSA 115.1 | ✓ Ro5 | ✓ Clean |
[C@@H]([C@H](C(=O)O)O)(C(=O)O)O
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC12503365 ZINC | 1.000 | 467.2 Da LogP -1.18 TPSA 250.2 | 2 viol. | ✓ Clean |
Nc1ccn([C@H]2C[C@@H](O)[C@@H](CO[P@](=O)(O)O[P@…
|
| ZINC13435050 ZINC | 1.000 | 467.2 Da LogP -1.18 TPSA 250.2 | 2 viol. | ✓ Clean |
Nc1ccn([C@@H]2C[C@H](O)[C@H](CO[P@@](=O)(O)O[P@…
|
| ZINC8215945 ZINC | 1.000 | 467.2 Da LogP -1.18 TPSA 250.2 | 2 viol. | ✓ Clean |
Nc1ccn([C@H]2C[C@H](O)[C@@H](CO[P@@](=O)(O)O[P@…
|
| ZINC13435042 ZINC | 0.959 | 387.2 Da LogP -1.30 TPSA 203.7 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2C[C@H](O)[C@H](CO[P@](=O)(O)OP(=O…
|
| ZINC14960508 ZINC | 0.959 | 387.2 Da LogP -1.30 TPSA 203.7 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2C[C@H](O)[C@@H](CO[P@](=O)(O)OP(=…
|
| ZINC142514175 ZINC | 0.818 | 483.2 Da LogP 0.19 TPSA 233.1 | 2 viol. | ✓ Clean |
Nc1ccn([C@@H]2C[C@H](O)[C@H](CO[P@@](=O)(O)O[P@…
|
| ZINC12503923 ZINC | 0.804 | 307.2 Da LogP -1.42 TPSA 157.1 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2C[C@@H](O)[C@@H](COP(=O)(O)O)O2)c…
|
| ZINC12503924 ZINC | 0.804 | 307.2 Da LogP -1.42 TPSA 157.1 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@H]2C[C@@H](O)[C@@H](COP(=O)(O)O)O2)c(…
|
| ZINC1532581 ZINC | 0.804 | 307.2 Da LogP -1.42 TPSA 157.1 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2C[C@@H](O)[C@H](COP(=O)(O)O)O2)c(…
|
| ZINC3645374 ZINC | 0.804 | 307.2 Da LogP -1.42 TPSA 157.1 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2C[C@H](O)[C@@H](COP(=O)(O)O)O2)c(…
|
| ZINC3861759 ZINC | 0.804 | 307.2 Da LogP -1.42 TPSA 157.1 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@H]2C[C@H](O)[C@@H](COP(=O)(O)O)O2)c(=…
|
| ZINC3869816 ZINC | 0.804 | 307.2 Da LogP -1.42 TPSA 157.1 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2C[C@H](O)[C@H](COP(=O)(O)O)O2)c(=…
|
| ZINC3869817 ZINC | 0.804 | 307.2 Da LogP -1.42 TPSA 157.1 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@H]2C[C@H](O)[C@H](COP(=O)(O)O)O2)c(=O…
|
| ZINC3869818 ZINC | 0.804 | 307.2 Da LogP -1.42 TPSA 157.1 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@H]2C[C@@H](O)[C@H](COP(=O)(O)O)O2)c(=…
|
| ZINC71404913 ZINC | 0.804 | 463.2 Da LogP 0.26 TPSA 209.7 | 1 viol. | ✓ Clean |
C[P@@](=O)(O[P@@](=O)(O)OC[C@H]1O[C@@H](n2ccc(N…
|
| ZINC71404916 ZINC | 0.804 | 463.2 Da LogP 0.26 TPSA 209.7 | 1 viol. | ✓ Clean |
C[P@@](=O)(O)O[P@@](C)(=O)O[P@@](=O)(O)OC[C@H]1…
|
| ZINC8215971 ZINC | 0.796 | 468.1 Da LogP -1.06 TPSA 244.4 | 2 viol. | ✓ Clean |
O=c1nc(O)ccn1[C@H]1C[C@H](O)[C@@H](CO[P@@](=O)(…
|
| ZINC111437949 ZINC | 0.741 | 481.2 Da LogP -0.72 TPSA 236.2 | 2 viol. | ✓ Clean |
CNc1ccn([C@@H]2C[C@H](O)[C@H](CO[P@@](=O)(O)O[P…
|
| ZINC12502055 ZINC | 0.732 | 483.2 Da LogP -2.21 TPSA 270.4 | 2 viol. | ✓ Clean |
Nc1ccn([C@@H]2O[C@@H](CO[P@@](=O)(O)O[P@@](=O)(…
|
| ZINC12502057 ZINC | 0.732 | 483.2 Da LogP -2.21 TPSA 270.4 | 2 viol. | ✓ Clean |
Nc1ccn([C@H]2O[C@@H](CO[P@@](=O)(O)O[P@@](=O)(O…
|
| ZINC12502058 ZINC | 0.732 | 483.2 Da LogP -2.21 TPSA 270.4 | 2 viol. | ✓ Clean |
Nc1ccn([C@@H]2O[C@H](CO[P@@](=O)(O)O[P@@](=O)(O…
|
| ZINC13431057 ZINC | 0.732 | 483.2 Da LogP -2.21 TPSA 270.4 | 2 viol. | ✓ Clean |
Nc1ccn([C@H]2O[C@@H](CO[P@@](=O)(O)O[P@@](=O)(O…
|
| ZINC13431059 ZINC | 0.732 | 483.2 Da LogP -2.21 TPSA 270.4 | 2 viol. | ✓ Clean |
Nc1ccn([C@@H]2O[C@@H](CO[P@@](=O)(O)O[P@@](=O)(…
|
| ZINC25726736 ZINC | 0.732 | 483.2 Da LogP -2.21 TPSA 270.4 | 2 viol. | ✓ Clean |
Nc1ccn([C@H]2O[C@@H](CO[P@@](=O)(O)O[P@@](=O)(O…
|
| ZINC3861746 ZINC | 0.732 | 483.2 Da LogP -2.21 TPSA 270.4 | 2 viol. | ✓ Clean |
Nc1ccn([C@@H]2O[C@H](CO[P@](=O)(O)O[P@@](=O)(O)…
|
| ZINC53683723 ZINC | 0.732 | 483.2 Da LogP -2.21 TPSA 270.4 | 2 viol. | ✓ Clean |
Nc1ccn([C@@H]2O[C@@H](CO[P@@](=O)(O)O[P@@](=O)(…
|
| ZINC82142138 ZINC | 0.732 | 483.2 Da LogP -2.21 TPSA 270.4 | 2 viol. | ✓ Clean |
Nc1ccn([C@@H]2O[C@H](CO[P@@](=O)(O)O[P@@](=O)(O…
|
| ZINC82142140 ZINC | 0.732 | 483.2 Da LogP -2.21 TPSA 270.4 | 2 viol. | ✓ Clean |
Nc1ccn([C@@H]2O[C@H](CO[P@@](=O)(O)O[P@@](=O)(O…
|
| ZINC142487928 ZINC | 0.719 | 483.2 Da LogP -1.48 TPSA 270.4 | 2 viol. | ✓ Clean |
Nc1nc(=O)n([C@@H]2C[C@H](O)[C@H](CO[P@@](=O)(O)…
|
| ZINC104864216 ZINC | 0.696 | 403.2 Da LogP -2.33 TPSA 223.9 | 2 viol. | ✓ Clean |
Nc1ccn([C@H]2O[C@@H](CO[P@](=O)(O)OP(=O)(O)O)[C…
|
| ZINC12504412 ZINC | 0.696 | 403.2 Da LogP -2.33 TPSA 223.9 | 2 viol. | ✓ Clean |
Nc1ccn([C@@H]2O[C@@H](CO[P@@](=O)(O)OP(=O)(O)O)…
|
| ZINC12504413 ZINC | 0.696 | 403.2 Da LogP -2.33 TPSA 223.9 | 2 viol. | ✓ Clean |
Nc1ccn([C@H]2O[C@@H](CO[P@@](=O)(O)OP(=O)(O)O)[…
|
| ZINC12504414 ZINC | 0.696 | 403.2 Da LogP -2.33 TPSA 223.9 | 2 viol. | ✓ Clean |
Nc1ccn([C@@H]2O[C@H](CO[P@@](=O)(O)OP(=O)(O)O)[…
|
| ZINC13431045 ZINC | 0.696 | 403.2 Da LogP -2.33 TPSA 223.9 | 2 viol. | ✓ Clean |
Nc1ccn([C@H]2O[C@@H](CO[P@@](=O)(O)OP(=O)(O)O)[…
|
| ZINC13431047 ZINC | 0.696 | 403.2 Da LogP -2.33 TPSA 223.9 | 2 viol. | ✓ Clean |
Nc1ccn([C@@H]2O[C@@H](CO[P@@](=O)(O)OP(=O)(O)O)…
|
| ZINC13548733 ZINC | 0.696 | 403.2 Da LogP -2.33 TPSA 223.9 | 2 viol. | ✓ Clean |
Nc1ccn([C@@H]2O[C@H](CO[P@@](=O)(O)OP(=O)(O)O)[…
|
| ZINC33913782 ZINC | 0.696 | 403.2 Da LogP -2.33 TPSA 223.9 | 2 viol. | ✓ Clean |
Nc1ccn([C@@H]2O[C@H](CO[P@@](=O)(O)OP(=O)(O)O)[…
|
| ZINC8215624 ZINC | 0.696 | 403.2 Da LogP -2.33 TPSA 223.9 | 2 viol. | ✓ Clean |
Nc1ccn([C@@H]2O[C@H](CO[P@@](=O)(O)OP(=O)(O)O)[…
|
| ZINC58633440 ZINC | 0.695 | 482.2 Da LogP -2.25 TPSA 276.2 | 2 viol. | ✓ Clean |
Nc1ccn([C@@H]2O[C@H](CO[P@@](=O)(O)O[P@@](=O)(O…
|
| ZINC62612120 ZINC | 0.695 | 481.2 Da LogP -0.87 TPSA 250.2 | 2 viol. | ✓ Clean |
Cc1cn([C@@H]2C[C@H](O)[C@H](CO[P@@](=O)(O)O[P@@…
|
| ZINC81982895 ZINC | 0.695 | 482.2 Da LogP -2.25 TPSA 276.2 | 2 viol. | ✓ Clean |
Nc1ccn([C@@H]2O[C@H](CO[P@@](=O)(O)O[P@@](=O)(O…
|
| ZINC81982899 ZINC | 0.695 | 482.2 Da LogP -2.25 TPSA 276.2 | 2 viol. | ✓ Clean |
Nc1ccn([C@@H]2O[C@H](CO[P@@](=O)(O)O[P@@](=O)(O…
|
| ZINC81982903 ZINC | 0.695 | 482.2 Da LogP -2.25 TPSA 276.2 | 2 viol. | ✓ Clean |
Nc1ccn([C@@H]2O[C@H](CO[P@@](=O)(O)O[P@@](=O)(O…
|
| ZINC12359024 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@H](O)[C@H](O)[C@@H](O)C(=O)O
|
| ZINC13533920 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@H](O)[C@@H](O)[C@@H](O)C(=O)O
|
| ZINC1549593 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@H](O)[C@H](O)[C@@H](O)[C@@H](O)C(=O)O
|
| ZINC2013424 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@@H](O)[C@@H](O)[C@H](O)C(=O)O
|
| ZINC3581021 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@H](O)[C@@H](O)[C@@H](O)[C@@H](O)C(=O)O
|
| ZINC5783661 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C(=O)O
|
| ZINC6072527 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@@H](O)[C@@H](O)[C@@H](O)C(=O)O
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.