Strong target candidate with converging metabolic, structural and chemical evidence.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 45.8% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 98.695 Higher values support similarity to known essential genes.
- DEG E-value
- 0.0 Smaller values mean stronger essential-gene similarity.
Structure confidence
- ColabFold pLDDT
- 82.35 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
PDB experimental structureP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTDAQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDREALRAALDGADMVFIAAGMGGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITIPNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGYAMMGSGVASGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNTIRAFASDNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVTNKQVQQPVMDRYQQHGMSPLTQEQKPAAKVVNDNTPQTAKEPDYLDIPAFLRKQAD
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Cytoplasmic
Gene Ontology (GO)
2- GO:0003924 Catalysis of the reaction: GTP + H2O = GDP + H+ + phosphate.
- GO:0005525 Binding to GTP, guanosine triphosphate.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 12 | 204 | SMART | SM00864 | Tubulin_4 |
| 12 | 204 | InterPro | IPR003008 | Tubulin/FtsZ, GTPase domain |
| 10 | 316 | FunFam | G3DSA:3.40.50.1440:FF:000023 | Cell division protein FtsZ |
| 13 | 172 | Pfam | PF00091 | Tubulin/FtsZ family, GTPase domain |
| 13 | 172 | InterPro | IPR003008 | Tubulin/FtsZ, GTPase domain |
| 12 | 207 | SUPERFAMILY | SSF52490 | Tubulin nucleotide-binding domain-like |
| 12 | 207 | InterPro | IPR036525 | Tubulin/FtsZ, GTPase domain superfamily |
| 188 | 210 | PRINTS | PR00423 | Cell division protein FtsZ signature |
| 188 | 210 | InterPro | IPR003008 | Tubulin/FtsZ, GTPase domain |
| 97 | 117 | PRINTS | PR00423 | Cell division protein FtsZ signature |
| 97 | 117 | InterPro | IPR003008 | Tubulin/FtsZ, GTPase domain |
| 211 | 232 | PRINTS | PR00423 | Cell division protein FtsZ signature |
| 211 | 232 | InterPro | IPR003008 | Tubulin/FtsZ, GTPase domain |
| 125 | 146 | PRINTS | PR00423 | Cell division protein FtsZ signature |
| 125 | 146 | InterPro | IPR003008 | Tubulin/FtsZ, GTPase domain |
| 96 | 117 | ProSitePatterns | PS01135 | FtsZ protein signature 2. |
| 96 | 117 | InterPro | IPR020805 | Cell division protein FtsZ, conserved site |
| 5 | 219 | Gene3D | G3DSA:3.40.50.1440 | Tubulin/FtsZ, GTPase domain |
| 5 | 219 | InterPro | IPR036525 | Tubulin/FtsZ, GTPase domain superfamily |
| 7 | 338 | NCBIfam | TIGR00065 | cell division protein FtsZ |
| 7 | 338 | InterPro | IPR000158 | Cell division protein FtsZ |
| 203 | 319 | SUPERFAMILY | SSF55307 | Tubulin C-terminal domain-like |
| 203 | 319 | InterPro | IPR008280 | Tubulin/FtsZ, C-terminal |
| 224 | 341 | Gene3D | G3DSA:3.30.1330.20 | - |
| 224 | 341 | InterPro | IPR037103 | Tubulin/FtsZ-like, C-terminal domain |
| 221 | 315 | Pfam | PF12327 | FtsZ family, C-terminal domain |
| 221 | 315 | InterPro | IPR024757 | Cell division protein FtsZ, C-terminal |
| 24 | 314 | CDD | cd02201 | FtsZ_type1 |
| 24 | 314 | InterPro | IPR000158 | Cell division protein FtsZ |
| 43 | 77 | ProSitePatterns | PS01134 | FtsZ protein signature 1. |
| 43 | 77 | InterPro | IPR020805 | Cell division protein FtsZ, conserved site |
| 349 | 371 | MobiDBLite | mobidb-lite | consensus disorder prediction |
| 349 | 366 | MobiDBLite | mobidb-lite | consensus disorder prediction |
| 224 | 341 | FunFam | G3DSA:3.30.1330.20:FF:000004 | Cell division protein FtsZ |
| 8 | 320 | PANTHER | PTHR30314 | CELL DIVISION PROTEIN FTSZ-RELATED |
| 8 | 320 | InterPro | IPR045061 | Tubulin-like protein FtsZ/CetZ |
| 8 | 343 | Hamap | MF_00909 | Cell division protein FtsZ [ftsZ]. |
| 8 | 343 | InterPro | IPR000158 | Cell division protein FtsZ |
| 206 | 324 | SMART | SM00865 | Tubulin_C_4 |
| 206 | 324 | InterPro | IPR018316 | Tubulin/FtsZ, 2-layer sandwich domain |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
6 + 1Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
PDB
6LL5
|
X-ray | — | A | — | Loaded | |
|
PDB
8GZV
|
X-ray | — | A | — | Loaded | |
|
PDB
8GZW
|
X-ray | — | A | — | Viewing | |
|
PDB
8H1O
|
X-ray | — | A | — | Loaded | |
|
PDB
8IBN
|
X-ray | — | A | — | Loaded | |
|
PDB
9ISK
|
X-ray | — | A | — | Loaded | |
|
ColabFold
KP13_01900
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural and bioactivity evidence are both available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| DVX RCSB PDB | Q6GHP9 | 781.3 Da LogP 7.61 TPSA 112.6 | 2 viol. | ✓ Clean |
[B-]1(n2c(ccc2CCC(=O)OC[C@H](c3nc(c(o3)Br)c4ccc…
|
|
| GSP RCSB PDB | P17865 | 539.2 Da LogP -2.22 TPSA 282.0 | 3 viol. | ✓ Clean |
c1nc2c(n1[C@H]3[C@@H]([C@@H]([C@H](O3)CO[P@](=O…
|
|
| MB3 RCSB PDB | P0A031 | 99.1 Da LogP 0.24 TPSA 20.3 | ✓ Ro5 | ✓ Clean |
CN1CCCC1=O
|
|
| ZI1 RCSB PDB | Q6GHP9 | 491.2 Da LogP 5.64 TPSA 78.4 | 1 viol. | ✓ Clean |
C[C@H](c1nc(c(o1)Br)c2ccc(cc2)C(F)(F)F)Oc3ccc(c…
|
|
| ZI6 RCSB PDB | Q6GHP9 | 477.2 Da LogP 5.08 TPSA 78.4 | 1 viol. | ✓ Clean |
c1cc(ccc1c2c(oc(n2)COc3ccc(c(c3F)C(=O)N)F)Br)C(…
|
|
| ZI7 RCSB PDB | Q6GHP9 | 389.3 Da LogP 3.67 TPSA 78.1 | ✓ Ro5 | ✓ Clean |
c1cc(c(c(c1OCc2nc3cc(cnc3s2)C(F)(F)F)F)C(=O)N)F
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
| Ligand | UniProt (homolog) | pchembl | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| CHEMBL5085404 ChEMBL | A5Z1V5 | 6.70 ~199.5 nM | 402.4 Da LogP 4.74 TPSA 64.3 | ✓ Ro5 | ✓ Clean |
CCC[C@H](COc1ccc(F)c(C(N)=O)c1F)Nc1cccc(C(F)(F)…
|
| CHEMBL5080731 ChEMBL | A5Z1V5 | 6.16 ~691.8 nM | 331.2 Da LogP 3.66 TPSA 52.3 | ✓ Ro5 | ✓ Clean |
NC(=O)c1c(F)ccc(OCc2cccc(C(F)(F)F)c2)c1F
|
| 3MB ChEMBL | P0A031 | — | 151.2 Da LogP 0.79 TPSA 52.3 | ✓ Ro5 | ✓ Clean |
COc1cccc(c1)C(=O)N
|
| 9PC ChEMBL | P17865 | — | 355.8 Da LogP 3.30 TPSA 78.1 | ✓ Ro5 | ✓ Clean |
c1cc(c(c(c1OCc2nc3cc(cnc3s2)Cl)F)C(=O)N)F
|
| 9TF ChEMBL | P0A9A6 | — | 256.2 Da LogP 1.58 TPSA 94.8 | ✓ Ro5 | Alert |
c1ccc2c(c1)C(=O)c3c(cc(c(c3C2=O)O)O)O
|
| CHEMBL1095212 ChEMBL | P0A031 | — | 306.3 Da LogP 3.47 TPSA 65.2 | ✓ Ro5 | ✓ Clean |
NC(=O)c1c(F)ccc(Oc2nc3ccccc3s2)c1F
|
| CHEMBL1095809 ChEMBL | P0A031 | — | 334.3 Da LogP 3.56 TPSA 65.2 | ✓ Ro5 | ✓ Clean |
Cc1ccc2nc(COc3ccc(F)c(C(N)=O)c3F)sc2c1
|
| CHEMBL1096128 ChEMBL | P0A031 | — | 396.4 Da LogP 4.92 TPSA 65.2 | ✓ Ro5 | ✓ Clean |
NC(=O)c1c(F)ccc(OCc2nc3ccc(-c4ccccc4)cc3s2)c1F
|
| CHEMBL1096989 ChEMBL | P0A031 | — | 350.3 Da LogP 3.26 TPSA 74.4 | ✓ Ro5 | ✓ Clean |
COc1ccc2nc(COc3ccc(F)c(C(N)=O)c3F)sc2c1
|
| CHEMBL1097096 ChEMBL | P0A031 | — | 396.4 Da LogP 4.92 TPSA 65.2 | ✓ Ro5 | ✓ Clean |
NC(=O)c1c(F)ccc(OCc2nc3cccc(-c4ccccc4)c3s2)c1F
|
| CHEMBL1097101 ChEMBL | P0A031 | — | 396.4 Da LogP 4.92 TPSA 65.2 | ✓ Ro5 | ✓ Clean |
NC(=O)c1c(F)ccc(OCc2nc3c(-c4ccccc4)cccc3s2)c1F
|
| CHEMBL1097435 ChEMBL | P0A031 | — | 386.4 Da LogP 3.64 TPSA 93.9 | ✓ Ro5 | ✓ Clean |
NC(=O)c1c(F)ccc(OCc2nc3cc(-c4ncc[nH]4)ccc3s2)c1F
|
| CHEMBL1097442 ChEMBL | P0A031 | — | 363.3 Da LogP 2.35 TPSA 108.3 | ✓ Ro5 | ✓ Clean |
NC(=O)c1ccc2sc(COc3ccc(F)c(C(N)=O)c3F)nc2c1
|
| CHEMBL1097443 ChEMBL | P0A031 | — | 364.3 Da LogP 2.95 TPSA 102.5 | ✓ Ro5 | ✓ Clean |
NC(=O)c1c(F)ccc(OCc2nc3cc(C(=O)O)ccc3s2)c1F
|
| CHEMBL1097767 ChEMBL | P0A031 | — | 335.3 Da LogP 2.83 TPSA 91.2 | ✓ Ro5 | ✓ Clean |
NC(=O)c1c(F)ccc(OCc2nc3cc(N)ccc3s2)c1F
|
| CHEMBL1097768 ChEMBL | P0A031 | — | 363.4 Da LogP 3.32 TPSA 68.5 | ✓ Ro5 | ✓ Clean |
CN(C)c1ccc2sc(COc3ccc(F)c(C(N)=O)c3F)nc2c1
|
| CHEMBL1097796 ChEMBL | P0A031 | — | 284.3 Da LogP 2.41 TPSA 65.2 | ✓ Ro5 | ✓ Clean |
Cc1cnc(COc2ccc(F)c(C(N)=O)c2F)s1
|
| CHEMBL1097798 ChEMBL | P0A031 | — | 267.2 Da LogP 1.34 TPSA 70.1 | ✓ Ro5 | ✓ Clean |
NC(=O)c1c(F)ccc(OCCn2cccn2)c1F
|
| CHEMBL3361105 ChEMBL | P0A031 | — | 355.7 Da LogP 2.94 TPSA 70.8 | ✓ Ro5 | ✓ Clean |
NC(=O)c1c(F)ccc(OC[C@@H]2COc3ccc(Cl)cc3O2)c1F
|
| CHEMBL3909931 ChEMBL | P0A031 | — | 379.3 Da LogP 2.07 TPSA 97.1 | ✓ Ro5 | ✓ Clean |
COC(=O)c1ccc2c(c1)OC(COc1ccc(F)c(C(N)=O)c1F)CO2
|
| CHEMBL3941121 ChEMBL | P0A031 | — | 345.3 Da LogP 2.26 TPSA 70.8 | ✓ Ro5 | ✓ Clean |
C#Cc1ccc2c(c1)OC(COc1ccc(F)c(C(N)=O)c1F)CO2
|
| CHEMBL4282358 ChEMBL | P17865 | — | 386.4 Da LogP 4.60 TPSA 78.4 | ✓ Ro5 | ✓ Clean |
CC(C)(C)c1ccc(-c2cc(COc3ccc(F)c(C(N)=O)c3F)no2)…
|
| CHEMBL461450 ChEMBL | P0A031 | — | 299.4 Da LogP 4.19 TPSA 52.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCOc1ccc(F)c(C(N)=O)c1F
|
| CHEMBL5084076 ChEMBL | A5Z1V5 | — | 379.3 Da LogP 2.00 TPSA 146.4 | ✓ Ro5 | ✓ Clean |
NC(=O)c1c(F)ccc(OCCNc2ccc([N+](=O)[O-])c3nonc23…
|
| CHEMBL5092407 ChEMBL | A5Z1V5 | — | 421.4 Da LogP 3.17 TPSA 146.4 | ✓ Ro5 | ✓ Clean |
CCCC(CNc1ccc([N+](=O)[O-])c2nonc12)Oc1ccc(F)c(C…
|
| CHEMBL5402658 ChEMBL | P0A031 | — | 387.8 Da LogP 5.27 TPSA 52.3 | 1 viol. | ✓ Clean |
Cc1cc(Cl)ccc1-c1cccc(COc2ccc(F)c(C(N)=O)c2F)c1
|
| G2P ChEMBL | A5Z1V5 | — | 521.2 Da LogP -2.22 TPSA 289.9 | 3 viol. | ✓ Clean |
c1nc2c(n1[C@H]3[C@@H]([C@@H]([C@H](O3)CO[P@](=O…
|
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC3861633 ZINC | 1.000 | 256.2 Da LogP 1.58 TPSA 94.8 | ✓ Ro5 | Alert |
O=C1c2ccccc2C(=O)c2c(O)c(O)cc(O)c21
|
| ZINC104869865 ZINC | 0.864 | 443.2 Da LogP -2.45 TPSA 252.6 | 2 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@H]2O[C@H](CO[P@@](=O)(O)OP(=O)(O…
|
| ZINC12504289 ZINC | 0.864 | 443.2 Da LogP -2.45 TPSA 252.6 | 2 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@@H]2O[C@H](CO[P@@](=O)(O)OP(=O)(…
|
| ZINC34541308 ZINC | 0.864 | 443.2 Da LogP -2.45 TPSA 252.6 | 2 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@@H]2O[C@H](CO[P@@](=O)(O)OP(=O)(…
|
| ZINC35000839 ZINC | 0.864 | 443.2 Da LogP -2.45 TPSA 252.6 | 2 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@H]2O[C@@H](CO[P@@](=O)(O)OP(=O)(…
|
| ZINC45284491 ZINC | 0.864 | 443.2 Da LogP -2.45 TPSA 252.6 | 2 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@H]2O[C@@H](CO[P@@](=O)(O)OP(=O)(…
|
| ZINC80639694 ZINC | 0.864 | 443.2 Da LogP -2.45 TPSA 252.6 | 2 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@@H]2O[C@H](CO[P@@](=O)(O)OP(=O)(…
|
| ZINC8215481 ZINC | 0.864 | 443.2 Da LogP -2.45 TPSA 252.6 | 2 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@@H]2O[C@H](CO[P@@](=O)(O)OP(=O)(…
|
| ZINC12501413 ZINC | 0.797 | 363.2 Da LogP -2.57 TPSA 206.0 | 1 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@@H]2O[C@H](COP(=O)(O)O)[C@@H](O)…
|
| ZINC12958448 ZINC | 0.797 | 363.2 Da LogP -2.57 TPSA 206.0 | 1 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@@H]2O[C@H](COP(=O)(O)O)[C@H](O)[…
|
| ZINC1532555 ZINC | 0.797 | 363.2 Da LogP -2.57 TPSA 206.0 | 1 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@H]2O[C@@H](COP(=O)(O)O)[C@H](O)[…
|
| ZINC16546189 ZINC | 0.797 | 363.2 Da LogP -2.57 TPSA 206.0 | 1 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@@H]2O[C@H](COP(=O)(O)O)[C@H](O)[…
|
| ZINC2159505 ZINC | 0.797 | 363.2 Da LogP -2.57 TPSA 206.0 | 1 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@@H]2O[C@H](COP(=O)(O)O)[C@@H](O)…
|
| ZINC3073318 ZINC | 0.797 | 363.2 Da LogP -2.57 TPSA 206.0 | 1 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@H]2O[C@@H](COP(=O)(O)O)[C@@H](O)…
|
| ZINC3869963 ZINC | 0.797 | 363.2 Da LogP -2.57 TPSA 206.0 | 1 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@H]2O[C@@H](COP(=O)(O)O)[C@@H](O)…
|
| ZINC3869965 ZINC | 0.797 | 363.2 Da LogP -2.57 TPSA 206.0 | 1 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@@H]2O[C@@H](COP(=O)(O)O)[C@@H](O…
|
| ZINC9334496 ZINC | 0.797 | 363.2 Da LogP -2.57 TPSA 206.0 | 1 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@H]2O[C@@H](COP(=O)(O)O)[C@H](O)[…
|
| ZINC12655867 ZINC | 0.778 | 478.4 Da LogP 3.73 TPSA 149.2 | ✓ Ro5 | Alert |
O=C1c2ccccc2C(=O)c2c(O)c(-c3cc(O)c4c(c3O)C(=O)c…
|
| ZINC40878032 ZINC | 0.764 | 355.8 Da LogP 3.30 TPSA 78.1 | ✓ Ro5 | ✓ Clean |
NC(=O)c1c(F)ccc(OCc2nc3cc(Cl)cnc3s2)c1F
|
| ZINC2168289 ZINC | 0.741 | 270.3 Da LogP 2.77 TPSA 52.6 | ✓ Ro5 | Alert |
COc1cccc(C(=O)C(=O)c2cccc(OC)c2)c1
|
| ZINC9315264 ZINC | 0.735 | 270.3 Da LogP 2.05 TPSA 81.4 | ✓ Ro5 | ✓ Clean |
COc1cccc(C(=O)Nc2cccc(C(N)=O)c2)c1
|
| ZINC2574623 ZINC | 0.714 | 242.3 Da LogP 2.93 TPSA 35.5 | ✓ Ro5 | ✓ Clean |
COc1cccc(C(=O)c2cccc(OC)c2)c1
|
| ZINC1532902 ZINC | 0.700 | 206.2 Da LogP -0.86 TPSA 132.1 | ✓ Ro5 | ✓ Clean |
O=C(O)CC[C@@](O)(CC(=O)O)C(=O)O
|
| ZINC2018106 ZINC | 0.700 | 206.2 Da LogP -0.86 TPSA 132.1 | ✓ Ro5 | ✓ Clean |
O=C(O)CC[C@](O)(CC(=O)O)C(=O)O
|
| ZINC4098664 ZINC | 0.700 | 254.2 Da LogP 2.18 TPSA 74.6 | ✓ Ro5 | Alert |
Cc1cc(O)c2c(c1O)C(=O)c1ccccc1C2=O
|
| ZINC4404481 ZINC | 0.700 | 274.7 Da LogP 2.53 TPSA 74.6 | ✓ Ro5 | Alert |
O=C1c2ccccc2C(=O)c2c(O)c(Cl)cc(O)c21
|
| ZINC71774763 ZINC | 0.691 | 432.3 Da LogP -2.23 TPSA 198.3 | 1 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@@H]2O[C@H](CO[P@](=O)(O)N3CCOCC3…
|
| ZINC5699363 ZINC | 0.680 | 304.2 Da LogP 0.70 TPSA 155.5 | 1 viol. | Alert |
O=C1c2c(O)cc(O)c(O)c2C(=O)c2c(O)cc(O)c(O)c21
|
| ZINC4743771 ZINC | 0.672 | 361.3 Da LogP -2.70 TPSA 182.6 | 1 viol. | ✓ Clean |
CS(=O)(=O)OC[C@H]1O[C@@H](n2cnc3c(=O)[nH]c(N)nc…
|
| ZINC4743772 ZINC | 0.672 | 361.3 Da LogP -2.70 TPSA 182.6 | 1 viol. | ✓ Clean |
CS(=O)(=O)OC[C@@H]1O[C@@H](n2cnc3c(=O)[nH]c(N)n…
|
| ZINC4743774 ZINC | 0.672 | 361.3 Da LogP -2.70 TPSA 182.6 | 1 viol. | ✓ Clean |
CS(=O)(=O)OC[C@H]1O[C@@H](n2cnc3c(=O)[nH]c(N)nc…
|
| ZINC4743775 ZINC | 0.672 | 361.3 Da LogP -2.70 TPSA 182.6 | 1 viol. | ✓ Clean |
CS(=O)(=O)OC[C@@H]1O[C@@H](n2cnc3c(=O)[nH]c(N)n…
|
| ZINC3873983 ZINC | 0.667 | 255.2 Da LogP 1.46 TPSA 100.6 | ✓ Ro5 | Alert |
Nc1c(O)cc(O)c2c1C(=O)c1ccccc1C2=O
|
| ZINC4411268 ZINC | 0.667 | 288.2 Da LogP 0.99 TPSA 135.3 | ✓ Ro5 | Alert |
O=C1c2c(O)ccc(O)c2C(=O)c2c(O)c(O)cc(O)c21
|
| ZINC465182 ZINC | 0.667 | 227.3 Da LogP 2.46 TPSA 52.3 | ✓ Ro5 | ✓ Clean |
COc1ccc(-c2cccc(C(N)=O)c2)cc1
|
| ZINC12503703 ZINC | 0.657 | 427.2 Da LogP -1.42 TPSA 232.3 | 2 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@@H]2C[C@H](O)[C@@H](CO[P@@](=O)(…
|
| ZINC8215878 ZINC | 0.657 | 427.2 Da LogP -1.42 TPSA 232.3 | 2 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@H]2C[C@H](O)[C@@H](CO[P@@](=O)(O…
|
| ZINC13327810 ZINC | 0.656 | 270.2 Da LogP 1.37 TPSA 94.8 | ✓ Ro5 | Alert |
O=C1c2ccccc2C(=O)c2c(O)c(CO)cc(O)c21
|
| ZINC13481221 ZINC | 0.656 | 284.2 Da LogP 1.57 TPSA 111.9 | ✓ Ro5 | Alert |
O=C(O)c1cc(O)c2c(c1O)C(=O)c1ccccc1C2=O
|
| ZINC3875972 ZINC | 0.656 | 320.3 Da LogP 1.12 TPSA 129.0 | ✓ Ro5 | Alert |
O=C1c2ccccc2C(=O)c2c(O)c(S(=O)(=O)O)cc(O)c21
|
| ZINC3847495 ZINC | 0.654 | 240.2 Da LogP 1.87 TPSA 74.6 | ✓ Ro5 | Alert |
O=C1c2ccccc2C(=O)c2c(O)ccc(O)c21
|
| ZINC3593496 ZINC | 0.652 | 206.2 Da LogP -1.16 TPSA 121.1 | ✓ Ro5 | ✓ Clean |
COC(=O)C[C@@](O)(CC(=O)O)C(=O)O
|
| ZINC3593497 ZINC | 0.652 | 206.2 Da LogP -1.16 TPSA 121.1 | ✓ Ro5 | ✓ Clean |
COC(=O)C[C@](O)(CC(=O)O)C(=O)O
|
| ZINC100058967 ZINC | 0.652 | 443.2 Da LogP -2.45 TPSA 252.6 | 2 viol. | ✓ Clean |
Nc1nc(=O)c2ncn([C@H]3O[C@H](CO[P@](=O)(O)OP(=O)…
|
| ZINC12504287 ZINC | 0.652 | 443.2 Da LogP -2.45 TPSA 252.6 | 2 viol. | ✓ Clean |
Nc1nc(=O)c2ncn([C@@H]3O[C@@H](CO[P@@](=O)(O)OP(…
|
| ZINC12504288 ZINC | 0.652 | 443.2 Da LogP -2.45 TPSA 252.6 | 2 viol. | ✓ Clean |
Nc1nc(=O)c2ncn([C@H]3O[C@@H](CO[P@@](=O)(O)OP(=…
|
| ZINC31308647 ZINC | 0.652 | 443.2 Da LogP -2.45 TPSA 252.6 | 2 viol. | ✓ Clean |
Nc1nc(=O)c2ncn([C@@H]3O[C@@H](CO[P@@](=O)(O)OP(…
|
| ZINC1698205 ZINC | 0.650 | 283.2 Da LogP -2.69 TPSA 159.5 | ✓ Ro5 | ✓ Clean |
Nc1nc2c(ncn2[C@H]2O[C@H](CO)[C@@H](O)[C@@H]2O)c…
|
| ZINC5605239 ZINC | 0.650 | 283.2 Da LogP -2.69 TPSA 159.5 | ✓ Ro5 | ✓ Clean |
Nc1nc2c(ncn2[C@@H]2O[C@@H](CO)[C@H](O)[C@H]2O)c…
|
| ZINC97973760 ZINC | 0.650 | 282.3 Da LogP -2.72 TPSA 165.3 | ✓ Ro5 | ✓ Clean |
NC[C@H]1O[C@@H](n2cnc3c(=O)[nH]c(N)nc32)[C@@H](…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.