KpKP13 Protein target profile

Dihydrodipicolinate reductase

Accession: KP13_01967

Gene: AHE46406.1 dapB 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GN28
Length 273
Pocket druggability (P2Rank · AlphaFold DB model) 0.751
Direct ligand evidence 0 58 total records
Functional annotation 1 EC 7 GO
Target summary

Strong target candidate with converging metabolic, structural and chemical evidence.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
4.6% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
91.575 Higher values support similarity to known essential genes.
DEG E-value
0.0 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
96.03 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.751
Structure A0A0H3GN28
Pocket Pocket 1
Druggability (FPocket) 0.729
Structure A0A0H3GN28
Pocket Pocket 2
ColabFold model
P2Rank 0.837 · Pocket 1
FPocket 0.06 · Pocket 5
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 218 / 4744 genomes with a hit
Prevalence 4.6%

Sequence

Primary amino-acid sequence viewer.

MHDAQIRVAIAGAGGRMGRQLIQAALQMEGVALGAALEREGSSLVGSDAGELAGAGKAGVAVQSSLAAVKDDFDVLIDFTRPEGTLNHLAFCREHGKGMVIGTTGFDDAGKQAIRDAAQDIAIVFAANFSVGVNVLLKLLEKAAKVMGDYTDIEIIEAHHRHKVDAPSGTALAMGEAIAGALNKDLKDCAVYSREGYTGERVPGTIGFATVRAGDIVGEHTAMFADIGERIEITHKASSRMTFANGAVRSALWLKGKKNGLFDMRDVLDLNSL

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 7 GO

Subcellular localization

Localization
Cytoplasmic

Enzyme Commission (EC)

1

Gene Ontology (GO)

7
  • GO:0008839 Catalysis of the reaction: (S)-2,3,4,5-tetrahydropyridine-2,6-dicarboxylate + NAD(P)+ + H2O = (2S,4S)-4-hydroxy-2,3,4,5-tetrahydrodipicolinate + NAD(P)H + H+.
  • GO:0009089 OBSOLETE. The chemical reactions and pathways resulting in the formation of lysine, via the intermediate diaminopimelate.
  • GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
  • GO:0051287 Binding to nicotinamide adenine dinucleotide, a coenzyme involved in many redox and biosynthetic reactions; binding may be to either the oxidized form, NAD+, or the reduced form, NADH.
  • GO:0050661 Binding to nicotinamide-adenine dinucleotide phosphate, a coenzyme involved in many redox and biosynthetic reactions; binding may be to either the oxidized form, NADP+, or the reduced form, NADPH.
  • GO:0016726 Catalysis of an oxidation-reduction (redox) reaction in which a CH2 group acts as a hydrogen or electron donor and reduces NAD+ or NADP.
  • GO:0019877 OBSOLETE. The chemical reactions and pathways resulting in the formation of diaminopimelate, both as an intermediate in lysine biosynthesis and as a component (as meso-diaminopimelate) of the peptidoglycan of Gram-negative bacterial cell walls.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

21 records
Show feature table
Start End DB Term Name
131 238 Gene3D G3DSA:3.30.360.10 Dihydrodipicolinate Reductase; domain 2
4 271 SUPERFAMILY SSF51735 NAD(P)-binding Rossmann-fold domains
4 271 InterPro IPR036291 NAD(P)-binding domain superfamily
6 269 NCBIfam TIGR00036 4-hydroxy-tetrahydrodipicolinate reductase
6 269 InterPro IPR023940 Dihydrodipicolinate reductase
5 269 PANTHER PTHR20836 DIHYDRODIPICOLINATE REDUCTASE
5 269 InterPro IPR023940 Dihydrodipicolinate reductase
131 240 SUPERFAMILY SSF55347 Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain
6 134 FunFam G3DSA:3.40.50.720:FF:000048 4-hydroxy-tetrahydrodipicolinate reductase
132 268 Pfam PF05173 Dihydrodipicolinate reductase, C-terminus
132 268 InterPro IPR022663 Dihydrodipicolinate reductase, C-terminal
6 268 Gene3D G3DSA:3.40.50.720 -
6 129 Pfam PF01113 Dihydrodipicolinate reductase, N-terminus
6 129 InterPro IPR000846 Dihydrodipicolinate reductase, N-terminal
4 272 PIRSF PIRSF000161 DHPR
4 272 InterPro IPR023940 Dihydrodipicolinate reductase
6 268 Hamap MF_00102 4-hydroxy-tetrahydrodipicolinate reductase [dapB].
6 268 InterPro IPR023940 Dihydrodipicolinate reductase
131 238 FunFam G3DSA:3.30.360.10:FF:000004 4-hydroxy-tetrahydrodipicolinate reductase
154 171 ProSitePatterns PS01298 Dihydrodipicolinate reductase signature.
154 171 InterPro IPR022664 Dihydrodipicolinate reductase, conserved site

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.751
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.141
Likely same site as FPocket 2 3.1 Å 10 shared residues 83% of smaller site
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.039
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #2
0.729 Unusual size
Likely same site as P2Rank 2 3.1 Å 10 shared residues 83% of smaller site
Show in viewer
Surrounding area
Residue sets
UniProt: Active site:159-159 Proton donor/acceptor
UniProt: Active site:163-163 Proton donor
UniProt: Binding site:102-104
UniProt: Binding site:12-17
UniProt: Binding site:126-129
UniProt: Binding site:160-160
UniProt: Binding site:169-170
UniProt: Binding site:38-38
UniProt: Binding site:39-39
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GN28
AlphaFold DB full sequence Viewing
ColabFold KP13_01967
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

58 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 8 records from similar proteins
Structural ligands 8 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
6PC PDB via homolog 123.1 Da · LogP 0.78 · TPSA 50.2 Open detail RCSB PDB
7FN PDB via homolog Detail RCSB PDB
A3D PDB via homolog Detail RCSB PDB
AE3 PDB via homolog Detail RCSB PDB
BEZ PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
6PC RCSB PDB P24703 123.1 Da LogP 0.78 TPSA 50.2 ✓ Ro5 ✓ Clean c1ccnc(c1)C(=O)O
7FN RCSB PDB Q8DEM0 156.1 Da LogP 0.68 TPSA 87.7 ✓ Ro5 ✓ Clean c1cc(oc1C(=O)O)C(=O)O
A3D RCSB PDB P04036 662.4 Da LogP -2.54 TPSA 295.1 3 viol. ✓ Clean CC(=O)c1ccc[n+](c1)[C@H]2[C@@H]([C@@H]([C@H](O2…
AE3 RCSB PDB P9WP23 134.2 Da LogP 0.03 TPSA 38.7 ✓ Ro5 ✓ Clean CCOCCOCCO
BEZ RCSB PDB A5U6C6 122.1 Da LogP 1.38 TPSA 37.3 ✓ Ro5 ✓ Clean c1ccc(cc1)C(=O)O
NHD RCSB PDB P04036 664.4 Da LogP -3.52 TPSA 315.3 3 viol. ✓ Clean c1cc(c[n+](c1)[C@H]2[C@@H]([C@@H]([C@H](O2)CO[P…
PDC RCSB PDB P04036 167.1 Da LogP 0.48 TPSA 87.5 ✓ Ro5 ✓ Clean c1cc(nc(c1)C(=O)O)C(=O)O
PE3 RCSB PDB P24703 634.8 Da LogP -0.81 TPSA 160.5 2 viol. ✓ Clean C(COCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCO)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.