Target candidate with partial support; inspect missing evidence before prioritizing.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 40.0 Lower values reduce human off-target concern.
- Human E-value
- 5.91e-18
- Gut microbiome similarity
- 4.6% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 91.146 Higher values support similarity to known essential genes.
- DEG E-value
- 6.429999999999999e-131 Smaller values mean stronger essential-gene similarity.
Structure confidence
- ColabFold pLDDT
- 95.96 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MNTLRIGLVSISDRASSGVYQDKGIPALEEWLARALTTPFELQTRLIPDEQATIEQTLCELVDEMGCHLVLTTGGTGPARRDVTPDATLAIADREMPGFGEQMRQVSLHFVPTAILSRQVGVIRKQALILNLPGQPKAIQETLEGVKDADGNVLVHGIFASVPYCVQLLEGPYVETDGRVVEAFRPKSARRETLS
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Cytoplasmic
Enzyme Commission (EC)
1Gene Ontology (GO)
3- GO:0006777 The chemical reactions and pathways resulting in the formation of the Mo-molybdopterin cofactor, essential for the catalytic activity of some enzymes. The cofactor consists of a mononuclear molybdenum (Mo) ion coordinated by one or two molybdopterin ligands.
- GO:0005524 Binding to ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
- GO:0061598 Catalysis of the reaction ATP + molybdopterin = diphosphate + adenylyl-molybdopterin.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 4 | 146 | NCBIfam | TIGR00177 | molybdenum cofactor biosynthesis domain |
| 4 | 146 | InterPro | IPR001453 | MoaB/Mog domain |
| 8 | 147 | Pfam | PF00994 | Probable molybdopterin binding domain |
| 8 | 147 | InterPro | IPR001453 | MoaB/Mog domain |
| 4 | 156 | CDD | cd00886 | MogA_MoaB |
| 4 | 156 | InterPro | IPR001453 | MoaB/Mog domain |
| 3 | 188 | SUPERFAMILY | SSF53218 | Molybdenum cofactor biosynthesis proteins |
| 3 | 188 | InterPro | IPR036425 | MoaB/Mog-like domain superfamily |
| 7 | 153 | SMART | SM00852 | MoCF_biosynth_3a |
| 7 | 153 | InterPro | IPR001453 | MoaB/Mog domain |
| 69 | 82 | ProSitePatterns | PS01078 | Molybdenum cofactor biosynthesis proteins signature 1. |
| 69 | 82 | InterPro | IPR008284 | Molybdenum cofactor biosynthesis, conserved site |
| 1 | 195 | Gene3D | G3DSA:3.40.980.10 | - |
| 1 | 195 | InterPro | IPR036425 | MoaB/Mog-like domain superfamily |
| 1 | 176 | PANTHER | PTHR43764 | MOLYBDENUM COFACTOR BIOSYNTHESIS |
| 1 | 194 | FunFam | G3DSA:3.40.980.10:FF:000005 | Molybdopterin biosynthesis mog protein |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GMZ7
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_01986
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 3F7 RCSB PDB | Q03555 | 268.2 Da LogP 0.55 TPSA 74.8 | ✓ Ro5 | ✓ Clean |
c1cc(ccc1N2C(=O)C=CC2=O)N3C(=O)C=CC3=O
|
|
| 3F8 RCSB PDB | Q03555 | 308.3 Da LogP -1.13 TPSA 93.2 | ✓ Ro5 | ✓ Clean |
C1=CC(=O)N(C1=O)CCOCCOCCN2C(=O)C=CC2=O
|
|
| B3P RCSB PDB | B2HEA7 | 282.3 Da LogP -4.01 TPSA 145.4 | 1 viol. | ✓ Clean |
C(CNC(CO)(CO)CO)CNC(CO)(CO)CO
|
|
| D8Z RCSB PDB | Q03555 | 298.4 Da LogP 2.84 TPSA 46.2 | ✓ Ro5 | ✓ Clean |
C[C@@H]1CC[C@H]2[C@H]([C@H](O[C@H]3[C@@]24[C@H]…
|
|
| D95 RCSB PDB | Q03555 | 384.4 Da LogP 2.60 TPSA 100.5 | ✓ Ro5 | ✓ Clean |
C[C@@H]1CC[C@H]2[C@H]([C@@H](O[C@H]3[C@@]24[C@H…
|
|
| MO RCSB PDB | Q03555 | 95.9 Da LogP -0.00 TPSA 0.0 | ✓ Ro5 | ✓ Clean |
[Mo]
|
|
| MOO RCSB PDB | Q03555 | 159.9 Da LogP -2.62 TPSA 80.3 | ✓ Ro5 | ✓ Clean |
[O-][Mo](=O)(=O)[O-]
|
|
| NWS RCSB PDB | Q39054 | 868.5 Da LogP -2.05 TPSA 384.2 | 3 viol. | ✓ Clean |
c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
|
|
| W RCSB PDB | Q03555 | 183.8 Da LogP -0.00 TPSA 0.0 | ✓ Ro5 | ✓ Clean |
[W+6]
|
|
| WO4 RCSB PDB | Q03555 | 247.8 Da LogP -2.62 TPSA 80.3 | ✓ Ro5 | ✓ Clean |
[O-][W](=O)(=O)[O-]
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC145341967 ZINC | 1.000 | 440.4 Da LogP -1.08 TPSA 120.9 | ✓ Ro5 | ✓ Clean |
O=C1C=CC(=O)N1CCOCCOCCOCCOCCOCCN1C(=O)C=CC1=O
|
| ZINC156949 ZINC | 1.000 | 268.2 Da LogP 0.55 TPSA 74.8 | ✓ Ro5 | ✓ Clean |
O=C1C=CC(=O)N1c1ccc(N2C(=O)C=CC2=O)cc1
|
| ZINC1857792026 ZINC | 1.000 | 484.5 Da LogP -1.06 TPSA 130.1 | ✓ Ro5 | ✓ Clean |
O=C1C=CC(=O)N1CCOCCOCCOCCOCCOCCOCCN1C(=O)C=CC1=O
|
| ZINC2387138 ZINC | 1.000 | 352.3 Da LogP -1.11 TPSA 102.4 | ✓ Ro5 | ✓ Clean |
O=C1C=CC(=O)N1CCOCCOCCOCCN1C(=O)C=CC1=O
|
| ZINC2572930 ZINC | 1.000 | 308.3 Da LogP -1.13 TPSA 93.2 | ✓ Ro5 | ✓ Clean |
O=C1C=CC(=O)N1CCOCCOCCN1C(=O)C=CC1=O
|
| ZINC4521259 ZINC | 1.000 | 282.3 Da LogP -4.01 TPSA 145.4 | 1 viol. | ✓ Clean |
OCC(CO)(CO)NCCCNC(CO)(CO)CO
|
| ZINC5372881 ZINC | 1.000 | 396.4 Da LogP -1.10 TPSA 111.7 | ✓ Ro5 | ✓ Clean |
O=C1C=CC(=O)N1CCOCCOCCOCCOCCN1C(=O)C=CC1=O
|
| ZINC64608163 ZINC | 1.000 | 384.4 Da LogP 2.60 TPSA 100.5 | ✓ Ro5 | ✓ Clean |
C[C@@H]1[C@H](OC(=O)CCC(=O)O)O[C@H]2O[C@@]3(C)C…
|
| ZINC77273545 ZINC | 0.950 | 264.2 Da LogP -1.15 TPSA 84.0 | ✓ Ro5 | ✓ Clean |
O=C1C=CC(=O)N1CCOCCN1C(=O)C=CC1=O
|
| ZINC1591996 ZINC | 0.833 | 344.3 Da LogP 2.21 TPSA 74.8 | ✓ Ro5 | ✓ Clean |
O=C1C=CC(=O)N1c1ccc(-c2ccc(N3C(=O)C=CC3=O)cc2)c…
|
| ZINC113221622 ZINC | 0.800 | 229.2 Da LogP -1.06 TPSA 76.1 | ✓ Ro5 | ✓ Clean |
O=C1C=CC(=O)N1CCOCCOCCO
|
| ZINC1857791904 ZINC | 0.800 | 449.5 Da LogP -0.98 TPSA 122.2 | ✓ Ro5 | ✓ Clean |
O=C1C=CC(=O)N1CCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC1857792820 ZINC | 0.800 | 316.4 Da LogP -1.06 TPSA 100.3 | ✓ Ro5 | ✓ Clean |
NCCOCCOCCOCCOCCN1C(=O)C=CC1=O
|
| ZINC1857792836 ZINC | 0.800 | 360.4 Da LogP -1.05 TPSA 109.6 | ✓ Ro5 | ✓ Clean |
NCCOCCOCCOCCOCCOCCN1C(=O)C=CC1=O
|
| ZINC211225534 ZINC | 0.800 | 361.4 Da LogP -1.01 TPSA 103.8 | ✓ Ro5 | ✓ Clean |
O=C1C=CC(=O)N1CCOCCOCCOCCOCCOCCO
|
| ZINC224746938 ZINC | 0.800 | 272.3 Da LogP -1.08 TPSA 91.1 | ✓ Ro5 | ✓ Clean |
NCCOCCOCCOCCN1C(=O)C=CC1=O
|
| ZINC2332239859 ZINC | 0.800 | 404.5 Da LogP -1.03 TPSA 118.8 | ✓ Ro5 | ✓ Clean |
NCCOCCOCCOCCOCCOCCOCCN1C(=O)C=CC1=O
|
| ZINC44831087 ZINC | 0.800 | 228.2 Da LogP -1.10 TPSA 81.9 | ✓ Ro5 | ✓ Clean |
NCCOCCOCCN1C(=O)C=CC1=O
|
| ZINC585665970 ZINC | 0.800 | 317.3 Da LogP -1.03 TPSA 94.5 | ✓ Ro5 | ✓ Clean |
O=C1C=CC(=O)N1CCOCCOCCOCCOCCO
|
| ZINC96299624 ZINC | 0.800 | 273.3 Da LogP -1.05 TPSA 85.3 | ✓ Ro5 | ✓ Clean |
O=C1C=CC(=O)N1CCOCCOCCOCCO
|
| ZINC106362085 ZINC | 0.758 | 455.5 Da LogP 2.11 TPSA 129.6 | ✓ Ro5 | ✓ Clean |
C[C@@H](NC(=O)CCC(=O)O[C@@H]1O[C@@H]2O[C@]3(C)C…
|
| ZINC14362 ZINC | 0.750 | 299.1 Da LogP 1.72 TPSA 37.4 | ✓ Ro5 | ✓ Clean |
O=C1C=CC(=O)N1c1ccc(I)cc1
|
| ZINC96640 ZINC | 0.750 | 207.6 Da LogP 1.77 TPSA 37.4 | ✓ Ro5 | ✓ Clean |
O=C1C=CC(=O)N1c1ccc(Cl)cc1
|
| ZINC97319 ZINC | 0.750 | 252.1 Da LogP 1.88 TPSA 37.4 | ✓ Ro5 | ✓ Clean |
O=C1C=CC(=O)N1c1ccc(Br)cc1
|
| ZINC106362035 ZINC | 0.734 | 481.5 Da LogP 2.59 TPSA 120.8 | ✓ Ro5 | ✓ Clean |
C[C@@H]1CC[C@H]2[C@@H](C)[C@H](OC(=O)CCC(=O)N3C…
|
| ZINC106362063 ZINC | 0.734 | 471.5 Da LogP 1.08 TPSA 149.8 | ✓ Ro5 | ✓ Clean |
C[C@@H]1CC[C@H]2[C@@H](C)[C@H](OC(=O)CCC(=O)N[C…
|
| ZINC106362113 ZINC | 0.734 | 483.6 Da LogP 2.74 TPSA 129.6 | ✓ Ro5 | ✓ Clean |
CC(C)[C@@H](NC(=O)CCC(=O)O[C@@H]1O[C@@H]2O[C@]3…
|
| ZINC106362067 ZINC | 0.723 | 485.5 Da LogP 1.47 TPSA 149.8 | ✓ Ro5 | ✓ Clean |
C[C@@H]1CC[C@H]2[C@@H](C)[C@H](OC(=O)CCC(=O)N[C…
|
| ZINC229932341 ZINC | 0.723 | 485.5 Da LogP 1.47 TPSA 149.9 | ✓ Ro5 | ✓ Clean |
C[C@H](O)[C@@H](NC(=O)CCC(=O)O[C@@H]1O[C@@H]2O[…
|
| ZINC229932354 ZINC | 0.723 | 485.5 Da LogP 1.47 TPSA 149.9 | ✓ Ro5 | ✓ Clean |
C[C@H](O)[C@H](NC(=O)CCC(=O)O[C@@H]1O[C@@H]2O[C…
|
| ZINC1046144 ZINC | 0.714 | 358.4 Da LogP 2.14 TPSA 74.8 | ✓ Ro5 | ✓ Clean |
O=C1C=CC(=O)N1c1ccc(Cc2ccc(N3C(=O)C=CC3=O)cc2)c…
|
| ZINC205372234 ZINC | 0.714 | 311.3 Da LogP -0.39 TPSA 74.3 | ✓ Ro5 | ✓ Clean |
C#CCOCCOCCOCCOCCN1C(=O)C=CC1=O
|
| ZINC2060424636 ZINC | 0.714 | 355.4 Da LogP -0.37 TPSA 83.5 | ✓ Ro5 | ✓ Clean |
C#CCOCCOCCOCCOCCOCCN1C(=O)C=CC1=O
|
| ZINC2069469067 ZINC | 0.714 | 359.4 Da LogP -0.32 TPSA 74.3 | ✓ Ro5 | ✓ Clean |
C[N+](C)(C)CCOCCOCCOCCOCCN1C(=O)C=CC1=O
|
| ZINC2069557053 ZINC | 0.714 | 403.5 Da LogP -0.30 TPSA 83.5 | ✓ Ro5 | ✓ Clean |
C[N+](C)(C)CCOCCOCCOCCOCCOCCN1C(=O)C=CC1=O
|
| ZINC230833776 ZINC | 0.714 | 287.3 Da LogP -0.95 TPSA 102.4 | ✓ Ro5 | ✓ Clean |
O=C(O)COCCOCCOCCN1C(=O)C=CC1=O
|
| ZINC230833805 ZINC | 0.714 | 331.3 Da LogP -0.94 TPSA 111.6 | ✓ Ro5 | ✓ Clean |
O=C(O)COCCOCCOCCOCCN1C(=O)C=CC1=O
|
| ZINC230833838 ZINC | 0.714 | 375.4 Da LogP -0.92 TPSA 120.8 | ✓ Ro5 | ✓ Clean |
O=C(O)COCCOCCOCCOCCOCCN1C(=O)C=CC1=O
|
| ZINC230833875 ZINC | 0.714 | 419.4 Da LogP -0.90 TPSA 130.1 | ✓ Ro5 | ✓ Clean |
O=C(O)COCCOCCOCCOCCOCCOCCN1C(=O)C=CC1=O
|
| ZINC38622096 ZINC | 0.714 | 372.3 Da LogP 2.96 TPSA 99.5 | ✓ Ro5 | Alert |
O=C1C=CC(=O)N1c1ccc(/N=N/c2ccc(N3C(=O)C=CC3=O)c…
|
| ZINC38919019 ZINC | 0.714 | 243.2 Da LogP -0.97 TPSA 93.1 | ✓ Ro5 | ✓ Clean |
O=C(O)COCCOCCN1C(=O)C=CC1=O
|
| ZINC71257140 ZINC | 0.714 | 345.3 Da LogP -0.55 TPSA 111.6 | ✓ Ro5 | ✓ Clean |
O=C(O)CCOCCOCCOCCOCCN1C(=O)C=CC1=O
|
| ZINC79016605 ZINC | 0.714 | 433.5 Da LogP -0.51 TPSA 130.1 | ✓ Ro5 | ✓ Clean |
O=C(O)CCOCCOCCOCCOCCOCCOCCN1C(=O)C=CC1=O
|
| ZINC823759 ZINC | 0.714 | 376.4 Da LogP 2.70 TPSA 74.8 | ✓ Ro5 | ✓ Clean |
O=C1C=CC(=O)N1c1ccc(Sc2ccc(N3C(=O)C=CC3=O)cc2)c…
|
| ZINC826893 ZINC | 0.714 | 360.3 Da LogP 2.34 TPSA 84.0 | ✓ Ro5 | ✓ Clean |
O=C1C=CC(=O)N1c1ccc(Oc2ccc(N3C(=O)C=CC3=O)cc2)c…
|
| ZINC842474 ZINC | 0.714 | 452.4 Da LogP 4.13 TPSA 93.2 | ✓ Ro5 | ✓ Clean |
O=C1C=CC(=O)N1c1ccc(Oc2ccc(Oc3ccc(N4C(=O)C=CC4=…
|
| ZINC96300340 ZINC | 0.714 | 257.2 Da LogP -0.58 TPSA 93.1 | ✓ Ro5 | ✓ Clean |
O=C(O)CCOCCOCCN1C(=O)C=CC1=O
|
| ZINC96300342 ZINC | 0.714 | 301.3 Da LogP -0.56 TPSA 102.4 | ✓ Ro5 | ✓ Clean |
O=C(O)CCOCCOCCOCCN1C(=O)C=CC1=O
|
| ZINC96503541 ZINC | 0.714 | 389.4 Da LogP -0.53 TPSA 120.8 | ✓ Ro5 | ✓ Clean |
O=C(O)CCOCCOCCOCCOCCOCCN1C(=O)C=CC1=O
|
| ZINC229932392 ZINC | 0.712 | 497.5 Da LogP 1.56 TPSA 141.1 | ✓ Ro5 | ✓ Clean |
C[C@@H]1CC[C@H]2[C@@H](C)[C@H](OC(=O)CCC(=O)N3C…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.