KpKP13 Protein target profile

5'-nucleotidase

Accession: KP13_02024

Gene: AHE46460.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GM80
Length 225
Pocket druggability (P2Rank · AlphaFold DB model) 0.816
Direct ligand evidence 0 56 total records
Functional annotation 0 EC 1 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
30.29 Lower values reduce human off-target concern.
Human E-value
6.95e-16
Gut microbiome similarity
2.0% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
96.3 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.816
Structure A0A0H3GM80
Pocket Pocket 1
Druggability (FPocket) 0.23
Structure A0A0H3GM80
Pocket Pocket 8
ColabFold model
P2Rank 0.818 · Pocket 1
FPocket 0.566 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 96 / 4744 genomes with a hit
Prevalence 2.0%

Sequence

Primary amino-acid sequence viewer.

MKWDWIFFDADETLFTFDSFSGLQRMFLDYSVTFTAEDFQDYQAVNKPLWVDYQNGAITSLQLQHQRFDSWAERLNVPPGELNDAFMNAMAEICAPLPGAVSLLNALQGKVRMGIITNGFTSLQQTRLERTGLRDHFDLLIISEQVGVAKPDARIFDYALAQAGNPPRSRVLMVGDTAESDIRGGVNAGLATCWLNAHQRELPADLEPDWTVTSLSELEQLLCKH

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 GO

Subcellular localization

Localization
Cytoplasmic

Gene Ontology (GO)

1
  • GO:0008253 Catalysis of the reaction: a 5'-ribonucleotide + H2O = a ribonucleoside + phosphate.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

24 records
Show feature table
Start End DB Term Name
97 196 CDD cd04305 HAD_Neu5Ac-Pase_like
5 218 Gene3D G3DSA:3.40.50.1000 -
5 218 InterPro IPR023214 HAD superfamily
92 195 NCBIfam TIGR01509 HAD-IA family hydrolase
92 195 InterPro IPR006439 HAD hydrolase, subfamily IA
4 221 NCBIfam TIGR02254 noncanonical pyrimidine nucleotidase, YjjG family
4 221 InterPro IPR011951 HAD-superfamily hydrolase, subfamily IA, YjjG/PynA
98 189 NCBIfam TIGR01549 HAD-IA family hydrolase
98 189 InterPro IPR006439 HAD hydrolase, subfamily IA
80 194 Pfam PF13419 Haloacid dehalogenase-like hydrolase
80 194 InterPro IPR041492 Haloacid dehalogenase-like hydrolase
137 153 PRINTS PR00413 Haloacid dehalogenase/epoxide hydrolase family signature
137 153 InterPro IPR006439 HAD hydrolase, subfamily IA
106 119 PRINTS PR00413 Haloacid dehalogenase/epoxide hydrolase family signature
106 119 InterPro IPR006439 HAD hydrolase, subfamily IA
184 197 PRINTS PR00413 Haloacid dehalogenase/epoxide hydrolase family signature
184 197 InterPro IPR006439 HAD hydrolase, subfamily IA
4 224 SFLD SFLDG01135 C1.5.6: HAD, Beta-PGM, Phosphatase Like
16 95 Gene3D G3DSA:1.10.150.240 Putative phosphatase; domain 2
16 95 InterPro IPR023198 Phosphoglycolate phosphatase-like, domain 2
1 223 PANTHER PTHR47478 -
4 224 SFLD SFLDG01129 C1.5: HAD, Beta-PGM, Phosphatase Like
3 222 SUPERFAMILY SSF56784 HAD-like
3 222 InterPro IPR036412 HAD-like superfamily

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.816
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #8
0.23
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GM80
AlphaFold DB full sequence Viewing
ColabFold KP13_02024
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

56 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 6 records from similar proteins
Structural ligands 6 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
AC0 PDB via homolog 120.2 Da · LogP 1.89 · TPSA 17.1 Open detail RCSB PDB
BUA PDB via homolog Detail RCSB PDB
LAC PDB via homolog Detail RCSB PDB
NHE PDB via homolog Detail RCSB PDB
TBU PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
AC0 RCSB PDB O58216 120.2 Da LogP 1.89 TPSA 17.1 ✓ Ro5 ✓ Clean CC(=O)c1ccccc1
BUA RCSB PDB Q53464 88.1 Da LogP 0.87 TPSA 37.3 ✓ Ro5 ✓ Clean CCCC(=O)O
LAC RCSB PDB Q53464 90.1 Da LogP -0.55 TPSA 57.5 ✓ Ro5 ✓ Clean C[C@H](C(=O)O)O
NHE RCSB PDB B6YTD6 207.3 Da LogP 0.80 TPSA 66.4 ✓ Ro5 ✓ Clean C1CCC(CC1)NCCS(=O)(=O)O
TBU RCSB PDB B6YTD6 74.1 Da LogP 0.78 TPSA 20.2 ✓ Ro5 ✓ Clean CC(C)(C)O
VO4 RCSB PDB Q8TBE9 114.9 Da LogP -3.69 TPSA 86.2 ✓ Ro5 ✓ Clean [O-][V](=O)([O-])[O-]

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.