Target candidate with partial support; inspect missing evidence before prioritizing.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 30.29 Lower values reduce human off-target concern.
- Human E-value
- 6.95e-16
- Gut microbiome similarity
- 2.0% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 0.0 Higher values support similarity to known essential genes.
Structure confidence
- ColabFold pLDDT
- 96.3 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MKWDWIFFDADETLFTFDSFSGLQRMFLDYSVTFTAEDFQDYQAVNKPLWVDYQNGAITSLQLQHQRFDSWAERLNVPPGELNDAFMNAMAEICAPLPGAVSLLNALQGKVRMGIITNGFTSLQQTRLERTGLRDHFDLLIISEQVGVAKPDARIFDYALAQAGNPPRSRVLMVGDTAESDIRGGVNAGLATCWLNAHQRELPADLEPDWTVTSLSELEQLLCKH
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Cytoplasmic
Gene Ontology (GO)
1- GO:0008253 Catalysis of the reaction: a 5'-ribonucleotide + H2O = a ribonucleoside + phosphate.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 97 | 196 | CDD | cd04305 | HAD_Neu5Ac-Pase_like |
| 5 | 218 | Gene3D | G3DSA:3.40.50.1000 | - |
| 5 | 218 | InterPro | IPR023214 | HAD superfamily |
| 92 | 195 | NCBIfam | TIGR01509 | HAD-IA family hydrolase |
| 92 | 195 | InterPro | IPR006439 | HAD hydrolase, subfamily IA |
| 4 | 221 | NCBIfam | TIGR02254 | noncanonical pyrimidine nucleotidase, YjjG family |
| 4 | 221 | InterPro | IPR011951 | HAD-superfamily hydrolase, subfamily IA, YjjG/PynA |
| 98 | 189 | NCBIfam | TIGR01549 | HAD-IA family hydrolase |
| 98 | 189 | InterPro | IPR006439 | HAD hydrolase, subfamily IA |
| 80 | 194 | Pfam | PF13419 | Haloacid dehalogenase-like hydrolase |
| 80 | 194 | InterPro | IPR041492 | Haloacid dehalogenase-like hydrolase |
| 137 | 153 | PRINTS | PR00413 | Haloacid dehalogenase/epoxide hydrolase family signature |
| 137 | 153 | InterPro | IPR006439 | HAD hydrolase, subfamily IA |
| 106 | 119 | PRINTS | PR00413 | Haloacid dehalogenase/epoxide hydrolase family signature |
| 106 | 119 | InterPro | IPR006439 | HAD hydrolase, subfamily IA |
| 184 | 197 | PRINTS | PR00413 | Haloacid dehalogenase/epoxide hydrolase family signature |
| 184 | 197 | InterPro | IPR006439 | HAD hydrolase, subfamily IA |
| 4 | 224 | SFLD | SFLDG01135 | C1.5.6: HAD, Beta-PGM, Phosphatase Like |
| 16 | 95 | Gene3D | G3DSA:1.10.150.240 | Putative phosphatase; domain 2 |
| 16 | 95 | InterPro | IPR023198 | Phosphoglycolate phosphatase-like, domain 2 |
| 1 | 223 | PANTHER | PTHR47478 | - |
| 4 | 224 | SFLD | SFLDG01129 | C1.5: HAD, Beta-PGM, Phosphatase Like |
| 3 | 222 | SUPERFAMILY | SSF56784 | HAD-like |
| 3 | 222 | InterPro | IPR036412 | HAD-like superfamily |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GM80
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_02024
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| AC0 RCSB PDB | O58216 | 120.2 Da LogP 1.89 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
CC(=O)c1ccccc1
|
|
| BUA RCSB PDB | Q53464 | 88.1 Da LogP 0.87 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCC(=O)O
|
|
| LAC RCSB PDB | Q53464 | 90.1 Da LogP -0.55 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
C[C@H](C(=O)O)O
|
|
| NHE RCSB PDB | B6YTD6 | 207.3 Da LogP 0.80 TPSA 66.4 | ✓ Ro5 | ✓ Clean |
C1CCC(CC1)NCCS(=O)(=O)O
|
|
| TBU RCSB PDB | B6YTD6 | 74.1 Da LogP 0.78 TPSA 20.2 | ✓ Ro5 | ✓ Clean |
CC(C)(C)O
|
|
| VO4 RCSB PDB | Q8TBE9 | 114.9 Da LogP -3.69 TPSA 86.2 | ✓ Ro5 | ✓ Clean |
[O-][V](=O)([O-])[O-]
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC1710230 ZINC | 1.000 | 207.3 Da LogP 0.80 TPSA 66.4 | ✓ Ro5 | ✓ Clean |
O=S(=O)(O)CCNC1CCCCC1
|
| ZINC3200262 ZINC | 0.842 | 252.3 Da LogP 2.95 TPSA 51.2 | ✓ Ro5 | Alert |
CC(=O)c1ccc(C(=O)C(=O)c2ccccc2)cc1
|
| ZINC36456728 ZINC | 0.800 | 224.3 Da LogP 3.12 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
CC(=O)c1ccc(C(=O)c2ccccc2)cc1
|
| ZINC2004372 ZINC | 0.786 | 221.3 Da LogP 1.19 TPSA 66.4 | ✓ Ro5 | ✓ Clean |
O=S(=O)(O)CCCNC1CCCCC1
|
| ZINC38364153 ZINC | 0.786 | 235.3 Da LogP 1.58 TPSA 66.4 | ✓ Ro5 | ✓ Clean |
O=S(=O)(O)CCCCNC1CCCCC1
|
| ZINC3593496 ZINC | 0.652 | 206.2 Da LogP -1.16 TPSA 121.1 | ✓ Ro5 | ✓ Clean |
COC(=O)C[C@@](O)(CC(=O)O)C(=O)O
|
| ZINC3593497 ZINC | 0.652 | 206.2 Da LogP -1.16 TPSA 121.1 | ✓ Ro5 | ✓ Clean |
COC(=O)C[C@](O)(CC(=O)O)C(=O)O
|
| ZINC1039926 ZINC | 0.625 | 220.3 Da LogP 3.29 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
CC(=O)c1ccc(C#Cc2ccccc2)cc1
|
| ZINC143028 ZINC | 0.625 | 228.3 Da LogP 4.04 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
CC(=O)c1ccc(Sc2ccccc2)cc1
|
| ZINC1440490 ZINC | 0.625 | 222.3 Da LogP 4.06 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
CC(=O)c1ccc(/C=C/c2ccccc2)cc1
|
| ZINC14686440 ZINC | 0.625 | 436.4 Da LogP -2.64 TPSA 247.9 | 1 viol. | ✓ Clean |
O=C(O)C[C@](O)(CC(=O)NCCCCNC(=O)C[C@@](O)(CC(=O…
|
| ZINC14686442 ZINC | 0.625 | 436.4 Da LogP -2.64 TPSA 247.9 | 1 viol. | ✓ Clean |
O=C(O)C[C@@](O)(CC(=O)NCCCCNC(=O)C[C@](O)(CC(=O…
|
| ZINC14686444 ZINC | 0.625 | 436.4 Da LogP -2.64 TPSA 247.9 | 1 viol. | ✓ Clean |
O=C(O)C[C@@](O)(CC(=O)NCCCCNC(=O)C[C@@](O)(CC(=…
|
| ZINC14981993 ZINC | 0.625 | 224.3 Da LogP 3.12 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
CC(=O)c1cccc(C(=O)c2ccccc2)c1
|
| ZINC1562037 ZINC | 0.625 | 210.3 Da LogP 3.48 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
CC(=O)c1ccc(Cc2ccccc2)cc1
|
| ZINC1675948 ZINC | 0.625 | 226.3 Da LogP 3.33 TPSA 41.1 | ✓ Ro5 | ✓ Clean |
CC(=O)c1ccc(NNc2ccccc2)cc1
|
| ZINC1845686 ZINC | 0.625 | 224.3 Da LogP 3.67 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
CC(=O)c1ccc(CCc2ccccc2)cc1
|
| ZINC21999250 ZINC | 0.625 | 211.3 Da LogP 3.63 TPSA 29.1 | ✓ Ro5 | ✓ Clean |
CC(=O)c1ccc(Nc2ccccc2)cc1
|
| ZINC261810 ZINC | 0.625 | 212.2 Da LogP 3.68 TPSA 26.3 | ✓ Ro5 | ✓ Clean |
CC(=O)c1ccc(Oc2ccccc2)cc1
|
| ZINC4798948 ZINC | 0.625 | 224.3 Da LogP 4.30 TPSA 41.8 | ✓ Ro5 | Alert |
CC(=O)c1ccc(/N=N/c2ccccc2)cc1
|
| ZINC50452 ZINC | 0.615 | 240.3 Da LogP 3.11 TPSA 43.4 | ✓ Ro5 | ✓ Clean |
CC(=O)c1ccc(OC(=O)c2ccccc2)cc1
|
| ZINC586797 ZINC | 0.615 | 239.3 Da LogP 3.14 TPSA 46.2 | ✓ Ro5 | ✓ Clean |
CC(=O)c1ccc(NC(=O)c2ccccc2)cc1
|
| ZINC1672966 ZINC | 0.611 | 210.2 Da LogP 2.75 TPSA 34.1 | ✓ Ro5 | Alert |
O=C(C(=O)c1ccccc1)c1ccccc1
|
| ZINC1401590 ZINC | 0.600 | 244.3 Da LogP 3.06 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
CC(=O)c1ccc([S@](=O)c2ccccc2)cc1
|
| ZINC143035 ZINC | 0.600 | 260.3 Da LogP 2.72 TPSA 51.2 | ✓ Ro5 | ✓ Clean |
CC(=O)c1ccc(S(=O)(=O)c2ccccc2)cc1
|
| ZINC34354396 ZINC | 0.600 | 224.3 Da LogP 4.04 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
CC(=O)c1ccc([C@@H](C)c2ccccc2)cc1
|
| ZINC34354398 ZINC | 0.600 | 224.3 Da LogP 4.04 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
CC(=O)c1ccc([C@H](C)c2ccccc2)cc1
|
| ZINC4073660 ZINC | 0.600 | 244.3 Da LogP 3.06 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
CC(=O)c1ccc([S@@](=O)c2ccccc2)cc1
|
| ZINC56557 ZINC | 0.600 | 238.3 Da LogP 3.76 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
CC(=O)c1ccc(-c2ccc(C(C)=O)cc2)cc1
|
| ZINC336592 ZINC | 0.583 | 224.3 Da LogP 3.12 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
CC(=O)c1ccccc1C(=O)c1ccccc1
|
| ZINC1529498 ZINC | 0.579 | 200.3 Da LogP 3.99 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCC(=O)O
|
| ZINC1530417 ZINC | 0.579 | 228.4 Da LogP 4.77 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCC(=O)O
|
| ZINC1577122 ZINC | 0.579 | 208.3 Da LogP 4.64 TPSA 0.0 | ✓ Ro5 | ✓ Clean |
C/C(=C(/C)c1ccccc1)c1ccccc1
|
| ZINC1590838 ZINC | 0.579 | 342.4 Da LogP 3.82 TPSA 68.3 | ✓ Ro5 | Alert |
O=C(C(=O)c1ccc(C(=O)C(=O)c2ccccc2)cc1)c1ccccc1
|
| ZINC16133932 ZINC | 0.579 | 474.5 Da LogP 4.88 TPSA 102.4 | ✓ Ro5 | Alert |
O=C(C(=O)c1ccc(C(=O)C(=O)c2ccc(C(=O)C(=O)c3cccc…
|
| ZINC1628119 ZINC | 0.579 | 214.3 Da LogP 4.38 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCC(=O)O
|
| ZINC3123872 ZINC | 0.579 | 208.3 Da LogP 4.64 TPSA 0.0 | ✓ Ro5 | ✓ Clean |
C/C(=C(\C)c1ccccc1)c1ccccc1
|
| ZINC117551598 ZINC | 0.577 | 253.3 Da LogP 3.57 TPSA 37.4 | ✓ Ro5 | ✓ Clean |
CC(=O)c1ccc(N(C(C)=O)c2ccccc2)cc1
|
| ZINC13398039 ZINC | 0.577 | 234.2 Da LogP -0.38 TPSA 121.1 | ✓ Ro5 | ✓ Clean |
CC(C)OC(=O)C[C@](O)(CC(=O)O)C(=O)O
|
| ZINC1556064 ZINC | 0.577 | 252.4 Da LogP 4.45 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
CC(=O)c1ccc(CCCCc2ccccc2)cc1
|
| ZINC1621063 ZINC | 0.577 | 268.3 Da LogP 2.82 TPSA 71.4 | ✓ Ro5 | ✓ Clean |
CC(=O)c1ccc(C(=O)c2ccccc2C(=O)O)cc1
|
| ZINC1720928 ZINC | 0.577 | 238.3 Da LogP 4.06 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
CC(=O)c1ccc(CCCc2ccccc2)cc1
|
| ZINC2039629 ZINC | 0.577 | 222.3 Da LogP 4.06 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
CC(=O)c1cccc(/C=C/c2ccccc2)c1
|
| ZINC2528012 ZINC | 0.577 | 234.2 Da LogP -0.38 TPSA 121.1 | ✓ Ro5 | ✓ Clean |
CC(C)OC(=O)C[C@@](O)(CC(=O)O)C(=O)O
|
| ZINC47679 ZINC | 0.577 | 254.3 Da LogP 3.53 TPSA 58.2 | ✓ Ro5 | ✓ Clean |
CC(=O)c1ccc(NC(=O)Nc2ccccc2)cc1
|
| ZINC1604259 ZINC | 0.571 | 346.3 Da LogP 4.99 TPSA 51.2 | ✓ Ro5 | ✓ Clean |
O=C(c1ccccc1)P(C(=O)c1ccccc1)C(=O)c1ccccc1
|
| ZINC2113934064 ZINC | 0.571 | 270.4 Da LogP 4.73 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCC(=O)CCCCCCCCCCCC(=O)O
|
| ZINC2113934089 ZINC | 0.571 | 256.4 Da LogP 4.34 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCC(=O)CCCCCCCCCCC(=O)O
|
| ZINC2378809 ZINC | 0.571 | 200.3 Da LogP 2.78 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCC(=O)CCCCCCC(=O)O
|
| ZINC5613445 ZINC | 0.571 | 240.3 Da LogP 2.06 TPSA 38.0 | ✓ Ro5 | ✓ Clean |
CC(=O)c1cc[n+](CC(=O)c2ccccc2)cc1
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.