KpKP13 Protein target profile

Ferric iron reductase protein fhuF

Accession: KP13_02032

Gene: fhuF AHE46468.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GRB8
Export view
Length 262
Pocket druggability (P2Rank · AlphaFold DB model) 0.057
Functional annotation 0 EC 2 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Main supporting evidence

No similar human protein detected The current BLAST sequence screen did not find a significant human match, lowering apparent off-target risk. Structure available AlphaFold DB model + ColabFold model

Risks to review

Microbiome similarity 64 of 4744 screened genomes (1.3%) have a significant similarity hit. Mixed conservation Core/accessory calls are not fully concordant. Weak predicted binding pocket FPocket selected-pocket score 0.34. Weak second pocket-predictor signal P2Rank predicted binding-site probability 0.06.

Evidence gaps

No metabolic context No SBML/network-derived reaction evidence is loaded for this protein. No ligand evidence No experimental PDB ligands, measured ChEMBL bioactivity, or proposed ZINC compound records are available.
Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
1.3% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
93.2 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.057
Structure A0A0H3GRB8
Pocket Pocket 1
Druggability (FPocket) 0.341
Structure A0A0H3GRB8
Pocket Pocket 3
ColabFold model
P2Rank 0.232 · Pocket 1
FPocket 0.7 · Pocket 1
Core conservation Accessory gene
Roary accessory
CoreCruncher accessory
Gut microbiome 64 / 4744 genomes with a hit
Prevalence 1.3%

Sequence

Primary amino-acid sequence viewer.

MAWRSLPLSDELIWRAPLPTAEHALAESIREKIATLRPHLLDFLRLDEPAPRHALTLAEWSQPIALRSLLATWSDHIYRHQPTLPREQKPLLSLWAQWYIGLLVPPLMLALLNEPQGLSLAPEHFHVEFHESGRAACFWIDVHSDADIERLSPQARMDALVTRTLQPVVEALAATGEINSKLIWSNTGYLINWYLGEMRALLGDERLAALRQHCFFEKQLADGQDNPLWRTVMLREGQLVRRTCCQRYRLPDVQQCGDCTLK

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

2 GO

Subcellular localization

Localization
Cytoplasmic

Gene Ontology (GO)

2
  • GO:0051537 Binding to a 2 iron, 2 sulfur (2Fe-2S) cluster; this cluster consists of two iron atoms, with two inorganic sulfur atoms found between the irons and acting as bridging ligands.
  • GO:0003824 Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

22 records
Show feature table
Start End DB Term Name
241 260 Pfam PF11575 FhuF 2Fe-2S C-terminal domain
241 260 InterPro IPR024726 Ferric siderophore reductase, C-terminal
125 139 PRINTS PR01714 Ferric iron reductase signature
125 139 InterPro IPR008090 Ferric iron reductase
93 108 PRINTS PR01714 Ferric iron reductase signature
93 108 InterPro IPR008090 Ferric iron reductase
56 73 PRINTS PR01714 Ferric iron reductase signature
56 73 InterPro IPR008090 Ferric iron reductase
173 189 PRINTS PR01714 Ferric iron reductase signature
173 189 InterPro IPR008090 Ferric iron reductase
197 212 PRINTS PR01714 Ferric iron reductase signature
197 212 InterPro IPR008090 Ferric iron reductase
241 259 PRINTS PR01714 Ferric iron reductase signature
241 259 InterPro IPR008090 Ferric iron reductase
16 32 PRINTS PR01714 Ferric iron reductase signature
16 32 InterPro IPR008090 Ferric iron reductase
215 231 PRINTS PR01714 Ferric iron reductase signature
215 231 InterPro IPR008090 Ferric iron reductase
93 238 Pfam PF06276 Ferric iron reductase FhuF-like transporter
93 238 InterPro IPR022770 Aerobactin siderophore biosynthesis IucA/IucC-like, C-terminal
87 262 NCBIfam TIGR03951 siderophore-iron reductase FhuF
87 262 InterPro IPR008090 Ferric iron reductase

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.057
Likely same site as FPocket 3 0.8 Å 8 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.053
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.038
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.027
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.024
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #3
0.341
Likely same site as P2Rank 1 0.8 Å 8 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 2 FPocket #2
0.207
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GRB8
AlphaFold DB — — full sequence — Viewing
ColabFold KP13_02032
ColabFold — — full sequence — Loaded

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

UniProt A0A0H3GRB8