Protein target profile

KP13_02473

PTS system protein, mannose/fructose/sorbose family, IID component

Genome: KpKP13 Gene: AHE46486.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GMU2
Export view
Length 279
Pocket druggability 0.943
Functional annotation 0 EC 3 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Main supporting evidence

No similar human protein detected The current BLAST sequence screen did not find a significant human match, lowering apparent off-target risk. Strong predicted binding pocket FPocket selected-pocket score 0.94. This is a computational pocket signal, not binding validation. Structure available AlphaFold DB model + ColabFold model

Risks to review

Microbiome similarity 155 of 4744 screened genomes (3.3%) have a significant similarity hit. This target also has a predicted binding pocket (FPocket 0.94) — check the ligand evidence before deprioritizing on off-target risk alone. Mixed conservation Core/accessory calls are not fully concordant. Weak second pocket-predictor signal P2Rank predicted binding-site probability 0.19.

Evidence gaps

No metabolic context No SBML/network-derived reaction evidence is loaded for this protein. No ligand evidence No experimental PDB ligands, measured ChEMBL bioactivity, or proposed ZINC compound records are available.
Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
3.3% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Localization

Localization
CytoplasmicMembrane

Structure confidence

ColabFold pLDDT
84.53 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.943
Structure A0A0H3GMU2
Pocket Pocket 3
P2Rank 0.187
Structure A0A0H3GMU2
Pocket Pocket 1
ColabFold model
FPocket 0.703 · Pocket 20
P2Rank 0.161 · Pocket 1
Core conservation Accessory gene
Roary accessory
CoreCruncher accessory
Gut microbiome 155 / 4744 genomes with a hit
Prevalence 3.3%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

UniProt A0A0H3GMU2

Sequence

Primary amino-acid sequence viewer.

MISEETLQPQAQEETRITPRDLRRVFWRSFQMEFSWNYERQMNLAFVYALIPVLKKLYPRREELAAALKRHLVFFNTTPHIVTLLLGITTAMEEKNSQQKNMDATAIDNVKASLMGPLAGLGDSFFWGTLRLIATGIGTSLALKGNILGPILFLLVFNVPHILVRWCFTRWGYVLGTGVLQRIQKSGMMESLTYGASIIGLMVVGAMTASMIDITIPLSFGAGEAKTQVQDIINDILPCMLPLVSFGIVYWLLGRKVKPLSIIGGMALVDILGSWIGLF

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Gene Ontology (GO)

3
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0009401 The uptake and phosphorylation of specific carbohydrates from the extracellular environment; uptake and phosphorylation are coupled, making the PTS a link between the uptake and metabolism of sugars; phosphoenolpyruvate is the original phosphate donor; phosphoenolpyruvate passes the phosphate via a signal transduction pathway, to enzyme 1 (E1), which in turn passes it on to the histidine protein, HPr; the next step in the system involves sugar-specific membrane-bound complex, enzyme 2 (EII), which transports the sugar into the cell; it includes the sugar permease, which catalyzes the transport reactions; EII is usually divided into three different domains, EIIA, EIIB, and EIIC.
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

22 records
Show feature table
Start End DB Term Name
147 168 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
169 191 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
190 212 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
71 92 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
232 253 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
60 70 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
1 41 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
93 146 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
260 278 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
42 59 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
17 279 Pfam PF03613 PTS system mannose/fructose/sorbose family IID component
17 279 InterPro IPR004704 Phosphotransferase system, mannose/fructose/sorbose family IID component
192 212 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
232 254 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
15 279 ProSiteProfiles PS51108 PTS_EIID domain profile.
15 279 InterPro IPR004704 Phosphotransferase system, mannose/fructose/sorbose family IID component
259 278 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
147 169 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
279 279 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
254 259 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
26 279 PANTHER PTHR32502 N-ACETYLGALACTOSAMINE PERMEASE II COMPONENT-RELATED
213 231 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Site 1 FPocket #3
0.943
Unusual size
Show in viewer
Surrounding area
Site 2 FPocket #1
0.641
Show in viewer
Surrounding area
Site 3 FPocket #2
0.298
Likely same site as P2Rank 2 1.9 Å 12 shared residues 92% of smaller site
Show in viewer
Surrounding area

Binding pockets · P2Rank

Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Site 1 P2Rank #1
0.187
Show in viewer
Surrounding area
Site 2 P2Rank #2
0.128
Likely same site as FPocket 2 1.9 Å 12 shared residues 92% of smaller site
Show in viewer
Surrounding area
Site 3 P2Rank #3
0.036
Show in viewer
Surrounding area
Site 4 P2Rank #4
0.015
Show in viewer
Surrounding area
Site 5 P2Rank #5
0.011
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GMU2
AlphaFold DB — — full sequence — Viewing
ColabFold KP13_02473
ColabFold — — full sequence — Loaded