KpKP13 Protein target profile
4-hydroxyphenylacetate 3-monooxygenase oxygenase component
Accession: KP13_02501
Strong target candidate with converging metabolic, structural and chemical evidence.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 1.2% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 0.0 Higher values support similarity to known essential genes.
Structure confidence
- ColabFold pLDDT
- 96.48 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MKPEDFRADAKRPLTGEEYLKSLQDGREIYIYGERVKDVTTHPAFRNAAASVAQLYDALHKPEMQDSLCWGTDTGSGGYTHKFFRVAKSADDLRQQRDAIAEWSRLSYGWMGRTPDYKAAFGCALGANPAFYGQFEQNARNWYTRIQETGLYFNHAIVNPPIDRHKPADEVKDVYIKLEKETDAGIIVSGAKVVATNSALTHYNMIGFGSAQVMGENPDFALMFVAPMDAEGVKLISRASYEMVAGATGSPYDYPLSCRFDENDAILVMDKVLIPWENVLIYRDFDRCRRWTMEGGFARMYPLQACVRLAVKLDFITALLKRSLECTGTLEFRGVQADLGEVVAWRNMFWALSDSMCSEATPWVNGAWLPDHAALQTYRVMAPMAYAKIKNIIERNVTSGLIYLPSSARDLNNPQIDQYLAKYVRGSNGMDHVERIKILKLMWDAIGSEFGGRHELYEINYSGSQDEIRLQCLRQAQSSGNMDKMMAMVDRCLSEYDQNGWTVPHLHNNADINMLDKLLK
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Cytoplasmic
Enzyme Commission (EC)
1Gene Ontology (GO)
5- GO:0016712 Catalysis of an oxidation-reduction (redox) reaction in which hydrogen or electrons are transferred from reduced flavin or flavoprotein and one other donor, and one atom of oxygen is incorporated into one donor.
- GO:0016627 Catalysis of an oxidation-reduction (redox) reaction in which a CH-CH group acts as a hydrogen or electron donor and reduces a hydrogen or electron acceptor.
- GO:0010124 The chemical reactions and pathways resulting in the breakdown of phenylacetate.
- GO:0050660 Binding to FAD, flavin-adenine dinucleotide, the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes, in either the oxidized form, FAD, or the reduced form, FADH2.
- GO:0052881 Catalysis of the reaction: (4-hydroxyphenyl)acetate + FADH(2) + O2 = 3,4-dihydroxyphenylacetate + FAD + H+ + H2O.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 152 | 282 | Gene3D | G3DSA:2.40.110.10 | - |
| 152 | 282 | InterPro | IPR046373 | Acyl-CoA oxidase/dehydrogenase, middle domain superfamily |
| 15 | 280 | Pfam | PF11794 | 4-hydroxyphenylacetate 3-hydroxylase N terminal |
| 15 | 280 | InterPro | IPR024674 | HpaB/PvcC/4-BUDH N-terminal |
| 152 | 282 | FunFam | G3DSA:2.40.110.10:FF:000026 | 4-hydroxyphenylacetate 3-monooxygenase oxygenase component |
| 14 | 151 | Gene3D | G3DSA:1.10.3140.10 | - |
| 288 | 488 | Pfam | PF03241 | 4-hydroxyphenylacetate 3-hydroxylase C terminal |
| 288 | 488 | InterPro | IPR024719 | HpaB/PvcC/4-BUDH C-terminal |
| 272 | 494 | SUPERFAMILY | SSF47203 | Acyl-CoA dehydrogenase C-terminal domain-like |
| 272 | 494 | InterPro | IPR036250 | Acyl-CoA dehydrogenase-like, C-terminal |
| 2 | 520 | NCBIfam | TIGR02310 | 4-hydroxyphenylacetate 3-monooxygenase, oxygenase component |
| 2 | 520 | InterPro | IPR012688 | 4-hydroxyphenylacetate 3-monooxygenase oxygenase component, gammaproteobacteria |
| 6 | 514 | PANTHER | PTHR36117 | 4-HYDROXYPHENYLACETATE 3-MONOOXYGENASE-RELATED |
| 6 | 514 | InterPro | IPR004925 | HpaB/PvcC/4-BUDH |
| 13 | 151 | FunFam | G3DSA:1.10.3140.10:FF:000001 | 4-hydroxyphenylacetate 3-monooxygenase oxygenase component |
| 13 | 282 | SUPERFAMILY | SSF56645 | Acyl-CoA dehydrogenase NM domain-like |
| 13 | 282 | InterPro | IPR009100 | Acyl-CoA dehydrogenase/oxidase, N-terminal and middle domain superfamily |
| 285 | 500 | Gene3D | G3DSA:1.20.140.10 | - |
| 11 | 501 | PIRSF | PIRSF000331 | HpaA_HpaB |
| 11 | 501 | InterPro | IPR004925 | HpaB/PvcC/4-BUDH |
| 1 | 518 | PIRSF | PIRSF500125 | 4_HPA_large |
| 1 | 518 | InterPro | IPR024677 | 4-HPA 3-monooxygenase large component/Pyoverdin chromophore biosynthetic protein |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Residue sets
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GR70
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_02501
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 4HP RCSB PDB | Q5SJP8 | 152.1 Da LogP 1.02 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
c1cc(ccc1CC(=O)O)O
|
|
| FDA RCSB PDB | Q53008 | 787.6 Da LogP -1.75 TPSA 363.3 | 3 viol. | ✓ Clean |
Cc1cc2c(cc1C)N(C3=C(N2)C(=O)NC(=O)N3)C[C@@H]([C…
|
|
| NPO RCSB PDB | Q53008 | 139.1 Da LogP 1.30 TPSA 63.4 | ✓ Ro5 | ✓ Clean |
c1cc(ccc1[N+](=O)[O-])O
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC32222424 ZINC | 0.864 | 228.2 Da LogP 2.69 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
O=C(O)Cc1ccc(-c2ccc(O)cc2)cc1
|
| ZINC1507107 ZINC | 0.857 | 215.2 Da LogP 2.97 TPSA 63.4 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(-c2ccc(O)cc2)cc1
|
| ZINC100009138 ZINC | 0.750 | 243.2 Da LogP 3.72 TPSA 88.1 | ✓ Ro5 | Alert |
O=[N+]([O-])c1ccc(/N=N\c2ccc(O)cc2)cc1
|
| ZINC100009140 ZINC | 0.750 | 243.2 Da LogP 3.72 TPSA 88.1 | ✓ Ro5 | Alert |
O=[N+]([O-])c1ccc(/N=N/c2ccc(O)cc2)cc1
|
| ZINC13836765 ZINC | 0.750 | 247.3 Da LogP 3.45 TPSA 63.4 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(Sc2ccc(O)cc2)cc1
|
| ZINC189331 ZINC | 0.750 | 279.3 Da LogP 2.13 TPSA 97.5 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(S(=O)(=O)c2ccc(O)cc2)cc1
|
| ZINC1911545360 ZINC | 0.750 | 241.2 Da LogP 3.47 TPSA 63.4 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(C=Cc2ccc(O)cc2)cc1
|
| ZINC225426 ZINC | 0.750 | 241.2 Da LogP 3.47 TPSA 63.4 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(/C=C/c2ccc(O)cc2)cc1
|
| ZINC254392989 ZINC | 0.750 | 243.2 Da LogP 3.72 TPSA 88.1 | ✓ Ro5 | Alert |
O=[N+]([O-])c1ccc(N=Nc2ccc(O)cc2)cc1
|
| ZINC33246164 ZINC | 0.750 | 241.2 Da LogP 3.47 TPSA 63.4 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(/C=C\c2ccc(O)cc2)cc1
|
| ZINC370769 ZINC | 0.750 | 231.2 Da LogP 3.09 TPSA 72.6 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(Oc2ccc(O)cc2)cc1
|
| ZINC38237571 ZINC | 0.750 | 243.2 Da LogP 2.53 TPSA 80.4 | ✓ Ro5 | ✓ Clean |
O=C(c1ccc(O)cc1)c1ccc([N+](=O)[O-])cc1
|
| ZINC8419013 ZINC | 0.750 | 230.2 Da LogP 3.04 TPSA 75.4 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(Nc2ccc(O)cc2)cc1
|
| ZINC1682664 ZINC | 0.682 | 270.3 Da LogP 2.61 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)Cc1ccc(-c2ccc(CC(=O)O)cc2)cc1
|
| ZINC391495 ZINC | 0.682 | 298.3 Da LogP 2.73 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)Cc1ccc(CCc2ccc(CC(=O)O)cc2)cc1
|
| ZINC21982756 ZINC | 0.667 | 299.3 Da LogP 2.63 TPSA 69.9 | ✓ Ro5 | Alert |
O=[N+]([O-])c1ccc(N2CCN(c3ccc(O)cc3)CC2)cc1
|
| ZINC33835370 ZINC | 0.667 | 273.2 Da LogP 2.94 TPSA 104.5 | ✓ Ro5 | ✓ Clean |
O=C(Nc1ccc(O)cc1)Nc1ccc([N+](=O)[O-])cc1
|
| ZINC575442763 ZINC | 0.667 | 314.3 Da LogP 2.66 TPSA 83.8 | ✓ Ro5 | ✓ Clean |
O=C(O)Cc1ccc(COCc2ccc(CC(=O)O)cc2)cc1
|
| ZINC33604885 ZINC | 0.630 | 202.2 Da LogP 2.17 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
O=C(O)Cc1ccc2cc(O)ccc2c1
|
| ZINC895813 ZINC | 0.630 | 209.2 Da LogP 0.14 TPSA 86.6 | ✓ Ro5 | ✓ Clean |
O=C(O)CNC(=O)Cc1ccc(O)cc1
|
| ZINC156360 ZINC | 0.625 | 262.0 Da LogP 1.92 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)Cc1ccc(I)cc1
|
| ZINC167159 ZINC | 0.625 | 215.0 Da LogP 2.08 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)Cc1ccc(Br)cc1
|
| ZINC1604377 ZINC | 0.619 | 320.3 Da LogP 4.84 TPSA 86.3 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(-c2ccc(-c3ccc([N+](=O)[O-])cc…
|
| ZINC1648209 ZINC | 0.619 | 244.2 Da LogP 3.17 TPSA 86.3 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(-c2ccc([N+](=O)[O-])cc2)cc1
|
| ZINC2173334 ZINC | 0.609 | 300.2 Da LogP 2.57 TPSA 120.4 | ✓ Ro5 | Alert |
O=C(C(=O)c1ccc([N+](=O)[O-])cc1)c1ccc([N+](=O)[…
|
| ZINC145787882 ZINC | 0.600 | 259.2 Da LogP 2.52 TPSA 89.7 | ✓ Ro5 | ✓ Clean |
O=C(Oc1ccc([N+](=O)[O-])cc1)c1ccc(O)cc1
|
| ZINC1699472 ZINC | 0.600 | 286.3 Da LogP 2.73 TPSA 83.8 | ✓ Ro5 | ✓ Clean |
O=C(O)Cc1ccc(Oc2ccc(CC(=O)O)cc2)cc1
|
| ZINC18036964 ZINC | 0.600 | 242.2 Da LogP 3.05 TPSA 75.7 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(/C=N/c2ccc(O)cc2)cc1
|
| ZINC18099346 ZINC | 0.600 | 242.2 Da LogP 3.05 TPSA 75.7 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(/N=C/c2ccc(O)cc2)cc1
|
| ZINC225997 ZINC | 0.600 | 258.2 Da LogP 2.55 TPSA 92.5 | ✓ Ro5 | ✓ Clean |
O=C(Nc1ccc(O)cc1)c1ccc([N+](=O)[O-])cc1
|
| ZINC2318 ZINC | 0.600 | 212.2 Da LogP 2.98 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)Cc1ccc(-c2ccccc2)cc1
|
| ZINC36019045 ZINC | 0.600 | 276.2 Da LogP 2.58 TPSA 126.7 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(O)c(-c2cc([N+](=O)[O-])ccc2O)…
|
| ZINC369682 ZINC | 0.600 | 294.3 Da LogP 2.10 TPSA 109.5 | ✓ Ro5 | Alert |
O=[N+]([O-])c1ccc(S(=O)(=O)Nc2ccc(O)cc2)cc1
|
| ZINC3750843 ZINC | 0.600 | 226.3 Da LogP 2.90 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)Cc1ccc(Cc2ccccc2)cc1
|
| ZINC39297153 ZINC | 0.600 | 228.2 Da LogP 2.52 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
O=C(Cc1ccc(O)cc1)c1ccc(O)cc1
|
| ZINC1688116 ZINC | 0.583 | 272.2 Da LogP 2.73 TPSA 103.3 | ✓ Ro5 | ✓ Clean |
O=C(c1ccc([N+](=O)[O-])cc1)c1ccc([N+](=O)[O-])c…
|
| ZINC5731136 ZINC | 0.581 | 278.3 Da LogP 2.44 TPSA 92.5 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc([S@](=O)Nc2ccc(O)cc2)cc1
|
| ZINC5731137 ZINC | 0.581 | 278.3 Da LogP 2.44 TPSA 92.5 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc([S@@](=O)Nc2ccc(O)cc2)cc1
|
| ZINC1256693 ZINC | 0.577 | 226.3 Da LogP 3.29 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
Cc1ccc(-c2ccc(CC(=O)O)cc2)cc1
|
| ZINC195766543 ZINC | 0.577 | 328.4 Da LogP 1.76 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
C[Si](C)(c1ccc(CC(=O)O)cc1)c1ccc(CC(=O)O)cc1
|
| ZINC220053800 ZINC | 0.577 | 242.3 Da LogP 2.47 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
O=C(O)Cc1ccc(-c2ccc(CO)cc2)cc1
|
| ZINC2539986 ZINC | 0.571 | 215.2 Da LogP 2.97 TPSA 63.4 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(-c2cccc(O)c2)cc1
|
| ZINC33427614 ZINC | 0.571 | 215.2 Da LogP 2.97 TPSA 63.4 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1cccc(-c2ccc(O)cc2)c1
|
| ZINC139174928 ZINC | 0.567 | 228.2 Da LogP 2.69 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
O=C(O)Cc1ccc(-c2cccc(O)c2)cc1
|
| ZINC1511626 ZINC | 0.565 | 249.0 Da LogP 2.20 TPSA 43.1 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(I)cc1
|
| ZINC1666827 ZINC | 0.565 | 202.0 Da LogP 2.36 TPSA 43.1 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(Br)cc1
|
| ZINC4616626 ZINC | 0.563 | 257.2 Da LogP 2.75 TPSA 87.8 | ✓ Ro5 | Alert |
O=[N+]([O-])c1ccc(N/N=C/c2ccc(O)cc2)cc1
|
| ZINC7718004 ZINC | 0.563 | 269.3 Da LogP 3.20 TPSA 80.4 | ✓ Ro5 | ✓ Clean |
O=C(/C=C/c1ccc([N+](=O)[O-])cc1)c1ccc(O)cc1
|
| ZINC104058859 ZINC | 0.560 | 395.3 Da LogP 3.70 TPSA 149.7 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(C(O)(c2ccc([N+](=O)[O-])cc2)c…
|
| ZINC2584252 ZINC | 0.560 | 203.2 Da LogP 0.84 TPSA 97.5 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1ccc(S(=O)(=O)O)cc1
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.