Protein target profile

KP13_02505

Carbon starvation protein

Genome: KpKP13 Gene: AHE46514.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GHS8
Export view
Length 716
Pocket druggability 0.996
Functional annotation 0 EC 3 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Main supporting evidence

Independent pocket support: FPocket + P2Rank Both predictors report a high-scoring binding site (FPocket 1.00, P2Rank 0.95). Use the 3D pocket comparison to verify whether they identify the same site. No similar human protein detected The current BLAST sequence screen did not find a significant human match, lowering apparent off-target risk. Core gene across strains Marked as conserved by both pan-genome tools: Roary and CoreCruncher. Strong predicted binding pocket FPocket selected-pocket score 1.00. This is a computational pocket signal, not binding validation. Review the complete evidence below

Risks to review

Microbiome similarity 186 of 4744 screened genomes (3.9%) have a significant similarity hit. This target also has a predicted binding pocket (FPocket 1.00) — check the ligand evidence before deprioritizing on off-target risk alone.

Evidence gaps

No metabolic context No SBML/network-derived reaction evidence is loaded for this protein. No ligand evidence No experimental PDB ligands, measured ChEMBL bioactivity, or proposed ZINC compound records are available.
Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
3.9% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
60.734 Higher values support similarity to known essential genes.
DEG E-value
0.0 Smaller values mean stronger essential-gene similarity.

Localization

Localization
CytoplasmicMembrane

Structure confidence

ColabFold pLDDT
92.45 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.996
Structure A0A0H3GHS8
Pocket Pocket 2
P2Rank 0.954
Structure A0A0H3GHS8
Pocket Pocket 1
ColabFold model
FPocket 0.933 · Pocket 44
P2Rank 0.893 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 186 / 4744 genomes with a hit
Prevalence 3.9%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

UniProt A0A0H3GHS8

Sequence

Primary amino-acid sequence viewer.

MDTKKLFKHIPWVVLGIIGAFCLSVVALRRGEHVSALWIVVASVSVYLVAYRYYSLYIAQKVMKLDPTRSTPAVINNDGLNYVPTNRYVLFGHHFAAIAGAGPLVGPVLAAQMGYLPGTLWLLAGVVLAGAVQDFMVLFISSRRNGASLGEMIKQEMGPVPGSIALFGCFLIMIIILAVLALIVVKALAESPWGVFTVCSTVPIALFMGIYMRFLRPGRVGEVSVIGIVLLVASIWFGGVIAHDPYWGPALTFKDTTITFTLIGYAFISALLPVWLILAPRDYLATFLKIGVIVGLALGIVILNPDLKMPAVTQYIDGTGPLWKGALFPFLFITIACGAVSGFHALIASGTTPKLLANETDARFIGYGAMLMESFVAVMALVAASIIEPGLYFAMNTPPAGLGIVMPNLHEMGGENAAMIAAQLKEVTVHAAATVSSWGFVISPEQILQTAKDIGEPSVLNRAGGAPTLAVGIAHVFHKIIPMADMGFWYHFGILFEALFILTALDAGTRAGRFMLQDLLGNFVPFLKKTDSLVAGIIGTAGCVGLWGYLLYQGVVDPLGGVKSLWPLFGISNQMLAAVALVLGTVVLVKMQRTKYIWVTVIPAAWLLLCTTWALGLKLFSSNPQMEGFFFMAQQYKEKIAAGGELTAQQIANMNHIVVNNYTNAGLSILFLVVVYSIIFYGIKTWLNVRNNKVRTDKETPYVPVPEGGVKTSSHH

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Gene Ontology (GO)

3
  • GO:0009267 Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of deprivation of nourishment.
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

54 records
Show feature table
Start End DB Term Name
665 687 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
304 322 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
364 386 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
34 56 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
487 614 Pfam PF13722 5TM C-terminal transporter carbon starvation CstA
487 614 InterPro IPR025299 CstA, C-terminal domain
243 261 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
121 140 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
325 347 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
220 242 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
488 505 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
486 505 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
223 242 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
12 29 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
344 363 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
116 120 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
684 716 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
532 551 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
533 552 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
89 111 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
55 94 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
595 617 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
286 303 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
566 588 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
30 34 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
142 161 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
34 693 PANTHER PTHR30252 INNER MEMBRANE PEPTIDE TRANSPORTER
286 305 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
121 141 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
162 185 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
364 387 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
553 563 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
323 343 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
280 285 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
186 190 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
506 532 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
388 487 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
35 54 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
662 683 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
12 29 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
564 589 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
596 616 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
262 279 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
161 183 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
193 215 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
191 211 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
212 222 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
590 595 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
34 403 Pfam PF02554 Carbon starvation protein CstA
34 403 InterPro IPR003706 CstA, N-terminal domain
1 11 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
257 279 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
95 115 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
617 661 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Site 1 FPocket #2
0.996
Show in viewer
Surrounding area
Site 2 FPocket #23
0.594
Likely same site as P2Rank 2 1.7 Å 9 shared residues 82% of smaller site
Show in viewer
Surrounding area
Site 3 FPocket #37
0.466
Likely same site as P2Rank 1 0.6 Å 23 shared residues 96% of smaller site
Unusual size
Show in viewer
Surrounding area
Site 4 FPocket #19
0.451
Show in viewer
Surrounding area

Binding pockets · P2Rank

Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Site 1 P2Rank #1
0.954
Likely same site as FPocket 37 0.6 Å 23 shared residues 96% of smaller site
Show in viewer
Surrounding area
Site 2 P2Rank #2
0.55
Likely same site as FPocket 23 1.7 Å 9 shared residues 82% of smaller site
Show in viewer
Surrounding area
Site 3 P2Rank #3
0.465
Show in viewer
Surrounding area
Site 4 P2Rank #4
0.4
Show in viewer
Surrounding area
Site 5 P2Rank #5
0.302
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GHS8
AlphaFold DB — — full sequence — Viewing
ColabFold KP13_02505
ColabFold — — full sequence — Loaded