KpKP13 Protein target profile

C4-dicarboxylate anaerobic carrier

Accession: KP13_01297

Gene: AHE46637.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GIC7
Export view
Length 472
Pocket druggability (P2Rank · AlphaFold DB model) 0.891
Functional annotation 0 EC 2 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Main supporting evidence

Independent pocket support: P2Rank + FPocket Both predictors report a high-scoring binding site (P2Rank 0.89, FPocket 0.76). Use the 3D pocket comparison to verify whether they identify the same site. No similar human protein detected The current BLAST sequence screen did not find a significant human match, lowering apparent off-target risk. Strong predicted binding pocket FPocket selected-pocket score 0.76. This is a computational pocket signal, not binding validation. Second pocket predictor agrees P2Rank predicted binding-site probability 0.89. Review the complete evidence below

Risks to review

Microbiome similarity 23 of 4744 screened genomes (0.5%) have a significant similarity hit. This target also has a predicted binding pocket (P2Rank 0.89) — check the ligand evidence before deprioritizing on off-target risk alone. Mixed conservation Core/accessory calls are not fully concordant.

Evidence gaps

No metabolic context No SBML/network-derived reaction evidence is loaded for this protein. No ligand evidence No experimental PDB ligands, measured ChEMBL bioactivity, or proposed ZINC compound records are available.
Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
0.5% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
91.07 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.891
Structure A0A0H3GIC7
Pocket Pocket 1
Druggability (FPocket) 0.763
Structure A0A0H3GIC7
Pocket Pocket 32
ColabFold model
P2Rank 0.844 · Pocket 1
FPocket 0.701 · Pocket 24
Core conservation Accessory gene
Roary accessory
CoreCruncher accessory
Gut microbiome 23 / 4744 genomes with a hit
Prevalence 0.5%

Sequence

Primary amino-acid sequence viewer.

MRIAKIKWAMPHCYALIFFIIILVALLTWCIPSGSFDYHSVTLPGGETKTLVIPGSYHLLDKVSSEGDLRQGIAAVLAAPMEGIIKAADVVAFVLIVGGAFGIILRTGAIERGLVALAERLAGKGILVIPIAMTLFSLGGATFGMSEEVIPLYAIFISLMFALGYDSMTAILILFLGTQIGYVGAMTNPFSVLIAQGVAGIQGNPQLWLRAIAWLVFTLLAIAYTMWYAHRVKRTPQKSPVYENDCRNREQFLSIQDTSVHFSIADRVIIIAFVLALAVISWGLITRGWYMVEIGSVFLALGLFSGIVGRMGISGMADSFVEGCKEFVYAAVVIGLARGILVVAENGRIIDTLLFGLSEMLEGLPQYAFTTLMLLGHNVITFFVPSSSGEAALTMPVLAPLGDLVGINKEAMVMAYQFGNGLTNLVSPTGGVLLAGLSIARIGFGQWLKAIAPLFPVLWIVSAAFAAISAWV

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

2 GO

Subcellular localization

Localization
CytoplasmicMembrane

Gene Ontology (GO)

2
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

40 records
Show feature table
Start End DB Term Name
35 83 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
327 349 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
450 471 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
13 35 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
247 468 PANTHER PTHR43652 BASIC AMINO ACID ANTIPORTER YFCC-RELATED
10 466 Pfam PF03606 C4-dicarboxylate anaerobic carrier
10 466 InterPro IPR018385 C4-dicarboxylate anaerobic carrier-like
364 386 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
294 314 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
176 181 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
180 202 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
202 206 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
106 125 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
268 290 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
87 109 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
126 146 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
386 421 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
472 472 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
230 267 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
207 229 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
418 440 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
445 449 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
422 444 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
12 34 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
121 143 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
153 175 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
286 296 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
1 11 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
364 385 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
182 201 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
152 175 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
316 326 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
207 229 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
297 315 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
327 344 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
268 285 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
345 363 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
147 151 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
450 471 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
84 105 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.891
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.849
Likely same site as FPocket 20 5.3 Å 12 shared residues 80% of smaller site
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.472
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.152
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.091
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #32
0.763
Likely same site as P2Rank 2 6.3 Å 11 shared residues 79% of smaller site
Show in viewer
Surrounding area
Pocket 2 FPocket #11
0.615
Show in viewer
Surrounding area
Pocket 3 FPocket #20
0.59
Likely same site as P2Rank 2 5.3 Å 12 shared residues 80% of smaller site
Show in viewer
Surrounding area
Pocket 4 FPocket #22
0.552
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GIC7
AlphaFold DB — — full sequence — Viewing
ColabFold KP13_01297
ColabFold — — full sequence — Loaded

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

UniProt A0A0H3GIC7