KpKP13 Protein target profile

HTH-type transcriptional regulator treR

Accession: KP13_01286

Gene: treR AHE46648.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GIB7
Length 315
Pocket druggability (P2Rank · AlphaFold DB model) 0.908
Direct ligand evidence 0 28 total records
Functional annotation 0 EC 6 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
1.9% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
92.3 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.908
Structure A0A0H3GIB7
Pocket Pocket 1
Druggability (FPocket) 0.612
Structure A0A0H3GIB7
Pocket Pocket 3
ColabFold model
P2Rank 0.881 · Pocket 1
FPocket 0.381 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 92 / 4744 genomes with a hit
Prevalence 1.9%

Sequence

Primary amino-acid sequence viewer.

MQNRLTIKDIARLSGVGKSTVSRVLNNESGVSERTRERVEAVMQQHGFSPSRSARAMRGQSDKVVAIIVTRLDSLSENLAVQTMLPAFYEQGYDPIMMESQFSPALVEEHLGMLARRNIDGVVLFGFTGIDEAMLAPWRDTLVLMARDAPGFASVCYDDEGAITLLMQRLYDRGHRHISFLGVPHSDVTTGERRHLAYLAFCKKHRLTPTAALPGLGMKQGYDTVASVLTAETSALVCATDTLALGASKYLQQQGRDALQLASVGSTPLMKFLHPEILTVDPGYAESGRRAARQLIEQIAGSVDPRQIVIPAALN

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

6 GO

Subcellular localization

Localization
Cytoplasmic

Gene Ontology (GO)

6
  • GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
  • GO:0045892 Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
  • GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
  • GO:0005991 The chemical reactions and pathways involving trehalose, a disaccharide that consists of two molecules of glucose and is isomeric with sucrose.
  • GO:0003700 A transcription regulator activity that modulates transcription of gene sets via selective and non-covalent binding to a specific double-stranded genomic DNA sequence (sometimes referred to as a motif) within a cis-regulatory region. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons.
  • GO:0000976 Binding to a specific sequence of DNA that is part of a regulatory region that controls transcription of that section of the DNA. The transcribed region might be described as a gene, cistron, or operon.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

28 records
Show feature table
Start End DB Term Name
8 59 CDD cd01392 HTH_LacI
8 59 InterPro IPR000843 LacI-type HTH domain
6 51 Pfam PF00356 Bacterial regulatory proteins, lacI family
6 51 InterPro IPR000843 LacI-type HTH domain
4 74 SMART SM00354 laci3
4 74 InterPro IPR000843 LacI-type HTH domain
4 314 NCBIfam TIGR02405 trehalose operon repressor TreR
4 314 InterPro IPR012771 Trehalose operon repressor
7 25 ProSitePatterns PS00356 LacI-type HTH domain signature.
3 60 SUPERFAMILY SSF47413 lambda repressor-like DNA-binding domains
3 60 InterPro IPR010982 Lambda repressor-like, DNA-binding domain superfamily
5 313 PANTHER PTHR30146 LACI-RELATED TRANSCRIPTIONAL REPRESSOR
1 61 FunFam G3DSA:1.10.260.40:FF:000021 Trehalose operon repressor
5 59 ProSiteProfiles PS50932 LacI-type HTH domain profile.
5 59 InterPro IPR000843 LacI-type HTH domain
6 16 PRINTS PR00036 LacI bacterial regulatory protein HTH signature
6 16 InterPro IPR000843 LacI-type HTH domain
16 26 PRINTS PR00036 LacI bacterial regulatory protein HTH signature
16 26 InterPro IPR000843 LacI-type HTH domain
63 314 SUPERFAMILY SSF53822 Periplasmic binding protein-like I
63 314 InterPro IPR028082 Periplasmic binding protein-like I
64 311 CDD cd01542 PBP1_TreR-like
67 301 Gene3D G3DSA:3.40.50.2300 -
163 279 Gene3D G3DSA:3.40.50.2300 -
1 61 Gene3D G3DSA:1.10.260.40 -
1 61 InterPro IPR010982 Lambda repressor-like, DNA-binding domain superfamily
168 312 Pfam PF13377 Periplasmic binding protein-like domain
168 312 InterPro IPR046335 Transcriptional regulator LacI/GalR-like, sensor domain

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.908
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.02
Likely same site as FPocket 3 1.8 Å 10 shared residues 100% of smaller site
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #3
0.612
Likely same site as P2Rank 2 1.8 Å 10 shared residues 100% of smaller site
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GIB7
AlphaFold DB full sequence Viewing
ColabFold KP13_01286
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

28 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 5 records from similar proteins
Structural ligands 5 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 23 similarity-based ZINC candidates
Best available ligand signal
171 PDB via homolog 201.2 Da · LogP 0.99 · TPSA 66.4 Open detail RCSB PDB
6MP PDB via homolog Detail RCSB PDB
ADE PDB via homolog Detail RCSB PDB
GUN PDB via homolog Detail RCSB PDB
HPA PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
171 RCSB PDB P46828 201.2 Da LogP 0.99 TPSA 66.4 ✓ Ro5 ✓ Clean c1ccc(cc1)NCCS(=O)(=O)O
6MP RCSB PDB P0ACP7 134.1 Da LogP 0.66 TPSA 54.5 ✓ Ro5 ✓ Clean Cc1c2c(nc[nH]2)ncn1
ADE RCSB PDB P0ACP7 135.1 Da LogP -0.06 TPSA 80.5 ✓ Ro5 ✓ Clean c1[nH]c2c(n1)c(ncn2)N
GUN RCSB PDB P0ACP7 151.1 Da LogP -0.77 TPSA 100.5 ✓ Ro5 ✓ Clean c1[nH]c2c(n1)C(=O)NC(=N2)N
HPA RCSB PDB P0ACP7 136.1 Da LogP -0.35 TPSA 74.4 ✓ Ro5 ✓ Clean c1[nH]c2c(n1)N=CNC2=O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.