KpKP13 Protein target profile

PTS system trehalose-specific EIIBC component

Accession: KP13_01285

Gene: treB AHE46649.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GMH8
Export view
Length 472
Pocket druggability (P2Rank · AlphaFold DB model) 0.924
Functional annotation 0 EC 8 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Main supporting evidence

No similar human protein detected The current BLAST sequence screen did not find a significant human match, lowering apparent off-target risk. Core gene across strains Marked as conserved by both pan-genome tools: Roary and CoreCruncher. Moderate predicted binding pocket FPocket selected-pocket score 0.50. This supports review but is not experimental validation. Second pocket predictor agrees P2Rank predicted binding-site probability 0.92. Review the complete evidence below

Risks to review

Microbiome similarity 256 of 4744 screened genomes (5.4%) have a significant similarity hit. This target also has a predicted binding pocket (P2Rank 0.92) — check the ligand evidence before deprioritizing on off-target risk alone.

Evidence gaps

No metabolic context No SBML/network-derived reaction evidence is loaded for this protein. No ligand evidence No experimental PDB ligands, measured ChEMBL bioactivity, or proposed ZINC compound records are available.
Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
5.4% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
88.64 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.924
Structure A0A0H3GMH8
Pocket Pocket 1
Druggability (FPocket) 0.496
Structure A0A0H3GMH8
Pocket Pocket 5
ColabFold model
P2Rank 0.895 · Pocket 1
FPocket 0.983 · Pocket 15
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 256 / 4744 genomes with a hit
Prevalence 5.4%

Sequence

Primary amino-acid sequence viewer.

MSKVNQQDIDKLIELVGGRGNIATVSHCITRLRFVLNDPAIARPKEIEQLRMVKGCFTNAGQFQVVIGTEVGDYYKALLATTGQTSADKEQVKQAARQNMKWHEQLISHFAEIFFPLLPALISGGLILGFRNVIGDLPMSNGQTLAQMHPSLKTIYDFLWLIGEAIFFYLPVGICWSAVKKMGGTPILGIVLGVTLVSPQLMNAYLLGQQVPEVWNFGLFTIAKVGYQAQVIPALLAGLALGFIETRLKRIVPDYLYLVIVPVCSLILAVFLAHAIIGPFGRLIGDGVAFAVRHLLTGSFAPIGAALFGFLYAPLVITGVHQTTLAIDMQMIQSMGGTPVWPLIALSNIAQASAVVGIIIASRKQNEREISVPAAISAYLGVTEPAMYGINLKYRFPMLCAMIGSGLAGLLCGLNGVLANGIGVGGLPGILSIQPTYWQVYAMAMAIAVVVPIILTSVVYQRKYRQGTLQIV

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

8 GO

Subcellular localization

Localization
CytoplasmicMembrane

Gene Ontology (GO)

8
  • GO:0008982 Catalysis of the PEP-dependent, phosphoryl transfer-driven transport of substances across a membrane. The transport happens by catalysis of the reaction: protein N-phosphohistidine + sugar(out) = protein histidine + sugar phosphate(in). This differs from primary and secondary active transport in that the solute is modified during transport.
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0015771 The directed movement of trehalose into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Trehalose is a disaccharide that consists of two molecules of glucose and is isomeric with sucrose.
  • GO:0009401 The uptake and phosphorylation of specific carbohydrates from the extracellular environment; uptake and phosphorylation are coupled, making the PTS a link between the uptake and metabolism of sugars; phosphoenolpyruvate is the original phosphate donor; phosphoenolpyruvate passes the phosphate via a signal transduction pathway, to enzyme 1 (E1), which in turn passes it on to the histidine protein, HPr; the next step in the system involves sugar-specific membrane-bound complex, enzyme 2 (EII), which transports the sugar into the cell; it includes the sugar permease, which catalyzes the transport reactions; EII is usually divided into three different domains, EIIA, EIIB, and EIIC.
  • GO:0015574 Enables the transfer of trehalose from one side of a membrane to the other. Trehalose is the disaccharide alpha-D-glucopyranosyl-alpha-D-glucopyranoside that acts of a reserve carbohydrate in certain fungi, algae and lichens.
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
  • GO:0016301 Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
  • GO:0090589 Catalysis of the PEP-dependent, phosphoryl transfer-driven transport of substances across a membrane. The transport happens by catalysis of the reaction: protein S-phosphocysteine + trehalose (out) = protein cysteine + trehalose-6-phosphate (in).

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

53 records
Show feature table
Start End DB Term Name
154 176 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
11 40 Pfam PF00367 phosphotransferase system, EIIB
11 40 InterPro IPR018113 Phosphotransferase system EIIB, cysteine phosphorylation site
208 226 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
245 255 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
158 179 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
372 391 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
225 244 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
106 130 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
398 418 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
106 128 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
361 371 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
300 320 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
227 244 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
30 111 NCBIfam TIGR00826 glucose PTS transporter subunit EIIB
30 111 InterPro IPR001996 Phosphotransferase system, IIB component, type 1
108 472 ProSiteProfiles PS51103 PTS_EIIC type-1 domain profile.
108 472 InterPro IPR013013 Phosphotransferase system, EIIC component, type 1
340 360 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
321 339 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
10 81 SUPERFAMILY SSF55604 Glucose permease domain IIB
10 81 InterPro IPR036878 Glucose permease domain IIB
405 427 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
437 459 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
6 460 NCBIfam TIGR01992 PTS system trehalose-specific EIIBC component
6 460 InterPro IPR011296 Phosphotransferase system, trehalose-specific IIBC component
419 437 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
392 397 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
6 88 ProSiteProfiles PS51098 PTS_EIIB type-1 domain profile.
6 88 InterPro IPR001996 Phosphotransferase system, IIB component, type 1
298 320 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
131 157 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
370 392 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
183 205 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
5 82 FunFam G3DSA:3.30.1360.60:FF:000001 PTS system glucose-specific IIBC component PtsG
21 38 ProSitePatterns PS01035 PTS EIIB domains cysteine phosphorylation site signature.
21 38 InterPro IPR018113 Phosphotransferase system EIIB, cysteine phosphorylation site
438 460 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
256 280 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
112 404 Pfam PF02378 Phosphotransferase system, EIIC
112 404 InterPro IPR003352 Phosphotransferase system, EIIC
461 472 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
6 83 CDD cd00212 PTS_IIB_glc
6 83 InterPro IPR018113 Phosphotransferase system EIIB, cysteine phosphorylation site
1 105 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
5 461 PANTHER PTHR30175 PHOSPHOTRANSFERASE SYSTEM TRANSPORT PROTEIN
180 185 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
4 81 Gene3D G3DSA:3.30.1360.60 Glucose permease domain IIB
4 81 InterPro IPR036878 Glucose permease domain IIB
256 278 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
341 360 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
186 207 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
281 299 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.924
Likely same site as FPocket 2 3.7 Å 14 shared residues 82% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.236
Likely same site as FPocket 5 3.4 Å 7 shared residues 88% of smaller site
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.17
Likely same site as FPocket 16 0.8 Å 13 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.064
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.061
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #5
0.496
Likely same site as P2Rank 2 3.4 Å 7 shared residues 88% of smaller site
Show in viewer
Surrounding area
Pocket 2 FPocket #16
0.46
Likely same site as P2Rank 3 0.8 Å 13 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 3 FPocket #2
0.335
Likely same site as P2Rank 1 3.7 Å 14 shared residues 82% of smaller site
Show in viewer
Surrounding area
Residue sets
UniProt: Active site:28-28 Phosphocysteine intermediate; for EIIB activity
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GMH8
AlphaFold DB — — full sequence — Viewing
ColabFold KP13_01285
ColabFold — — full sequence — Loaded

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

UniProt A0A0H3GMH8