Protein target profile

KP13_01224

Primosomal replication protein n

Genome: KpKP13 Gene: priB AHE46710.1 3D evidence: Experimental + ColabFold model UniProt A6THB2
Length 104
Pocket druggability 0.366
Direct ligand evidence 0 17 total records
Functional annotation 0 EC 3 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
1.8% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
93.269 Higher values support similarity to known essential genes.
DEG E-value
1.0400000000000001e-70 Smaller values mean stronger essential-gene similarity.

Localization

Localization
Unknown

Structure confidence

ColabFold pLDDT
94.62 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

PDB experimental structure

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.366
Structure 4APV
Pocket Pocket 1
P2Rank
Structure 4APV
Pocket No pockets
ColabFold model
FPocket 0.282 · Pocket 1
P2Rank 0.052 · Pocket 1
Core conservation Accessory gene
Roary accessory
CoreCruncher accessory
Gut microbiome 87 / 4744 genomes with a hit
Prevalence 1.8%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Structure

Sequence

Primary amino-acid sequence viewer.

MTNRLELSGIICRTPLRKVSPSGIPHCQFVLEHRSVQEEAGFHRQAWCQMPVIISGHENQAITHSITVGSAVTVRGFISCHKAKNGLSKMVLHAEQIELIDSGD

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Gene Ontology (GO)

3
  • GO:0030894 A multi-component enzymatic machine at the replication fork which mediates DNA replication. Includes DNA primase, one or more DNA polymerases, DNA helicases, and other proteins.
  • GO:0006260 The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by the origin recognition complex, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
  • GO:0003697 Binding to single-stranded DNA.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

15 records
Show feature table
Start End DB Term Name
2 100 Hamap MF_00720 Primosomal replication protein N [priB].
2 100 InterPro IPR023646 Primosomal replication protein PriB
3 99 NCBIfam TIGR04418 primosomal replication protein N
3 99 InterPro IPR023646 Primosomal replication protein PriB
1 103 SUPERFAMILY SSF50249 Nucleic acid-binding proteins
1 103 InterPro IPR012340 Nucleic acid-binding, OB-fold
1 104 FunFam G3DSA:2.40.50.140:FF:000077 Primosomal replication protein N
3 88 Pfam PF00436 Single-strand binding protein family
3 88 InterPro IPR000424 Primosome PriB/single-strand DNA-binding
1 101 PIRSF PIRSF003135 Primosomal_n
1 101 InterPro IPR023646 Primosomal replication protein PriB
1 101 ProSiteProfiles PS50935 Single-strand binding (SSB) domain profile.
1 101 InterPro IPR000424 Primosome PriB/single-strand DNA-binding
1 104 Gene3D G3DSA:2.40.50.140 -
1 104 InterPro IPR012340 Nucleic acid-binding, OB-fold

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Site 1 FPocket #1
0.366
Unusual size
Show in viewer
Surrounding area
All structural evidence 1 experimental · 1 predicted

Structural evidence

1 + 1

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
PDB 4APV
X-ray A Viewing
ColabFold KP13_01224
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

17 records
Chemistry signal

Only proposed virtual-screening candidates are available for this target.

Direct evidence 0 same-protein records
Transferred evidence 0 records from similar proteins
Structural ligands 0 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 17 similarity-based ZINC candidates
Best available ligand signal
ZINC5131766 ZINC proposed compound Tanimoto 0.538 224.3 Da · LogP -1.26 · TPSA 92.4 Open detail ZINC
ZINC1730666 ZINC proposed compound · Tanimoto 0.524 Detail ZINC
ZINC1730667 ZINC proposed compound · Tanimoto 0.524 Detail ZINC
ZINC1730669 ZINC proposed compound · Tanimoto 0.524 Detail ZINC
ZINC3055005 ZINC proposed compound · Tanimoto 0.524 Detail ZINC

Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).

Show only:
Ligand Tanimoto MW · LogP · TPSA Lipinski PAINS SMILES
ZINC5131766 ZINC 0.538 224.3 Da LogP -1.26 TPSA 92.4 ✓ Ro5 ✓ Clean N[C@@H](CS)C(=O)N[C@@H](CS)C(=O)O
ZINC1730666 ZINC 0.524 208.2 Da LogP -1.46 TPSA 126.6 ✓ Ro5 ✓ Clean N[C@@H](CSC[C@H](N)C(=O)O)C(=O)O
ZINC1730667 ZINC 0.524 208.2 Da LogP -1.46 TPSA 126.6 ✓ Ro5 ✓ Clean N[C@H](CSC[C@H](N)C(=O)O)C(=O)O
ZINC1730669 ZINC 0.524 208.2 Da LogP -1.46 TPSA 126.6 ✓ Ro5 ✓ Clean N[C@H](CSC[C@@H](N)C(=O)O)C(=O)O
ZINC3055005 ZINC 0.524 204.2 Da LogP -0.63 TPSA 126.6 ✓ Ro5 ✓ Clean N[C@@H](CCCC[C@H](N)C(=O)O)C(=O)O
ZINC3055007 ZINC 0.524 204.2 Da LogP -0.63 TPSA 126.6 ✓ Ro5 ✓ Clean N[C@@H](CCCC[C@@H](N)C(=O)O)C(=O)O
ZINC3055010 ZINC 0.524 204.2 Da LogP -0.63 TPSA 126.6 ✓ Ro5 ✓ Clean N[C@H](CCCC[C@@H](N)C(=O)O)C(=O)O
ZINC1555366 ZINC 0.500 232.3 Da LogP 0.15 TPSA 126.6 ✓ Ro5 ✓ Clean N[C@@H](CCCCCC[C@H](N)C(=O)O)C(=O)O
ZINC1555367 ZINC 0.500 232.3 Da LogP 0.15 TPSA 126.6 ✓ Ro5 ✓ Clean N[C@@H](CCCCCC[C@@H](N)C(=O)O)C(=O)O
ZINC1555369 ZINC 0.500 232.3 Da LogP 0.15 TPSA 126.6 ✓ Ro5 ✓ Clean N[C@H](CCCCCC[C@@H](N)C(=O)O)C(=O)O
ZINC1720127 ZINC 0.500 218.3 Da LogP -0.24 TPSA 126.6 ✓ Ro5 ✓ Clean N[C@@H](CCCCC[C@H](N)C(=O)O)C(=O)O
ZINC1720128 ZINC 0.500 218.3 Da LogP -0.24 TPSA 126.6 ✓ Ro5 ✓ Clean N[C@@H](CCCCC[C@@H](N)C(=O)O)C(=O)O
ZINC1720130 ZINC 0.500 218.3 Da LogP -0.24 TPSA 126.6 ✓ Ro5 ✓ Clean N[C@H](CCCCC[C@@H](N)C(=O)O)C(=O)O
ZINC3623257 ZINC 0.500 202.2 Da LogP -0.85 TPSA 126.6 ✓ Ro5 ✓ Clean N[C@@H](C/C=C/C[C@@H](N)C(=O)O)C(=O)O
ZINC40439568 ZINC 0.500 208.2 Da LogP -2.19 TPSA 112.7 ✓ Ro5 ✓ Clean N[C@@H](CS)C(=O)N[C@@H](CO)C(=O)O
ZINC4580672 ZINC 0.500 202.2 Da LogP -0.85 TPSA 126.6 ✓ Ro5 ✓ Clean N[C@@H](C/C=C/C[C@H](N)C(=O)O)C(=O)O
ZINC4580676 ZINC 0.500 202.2 Da LogP -0.85 TPSA 126.6 ✓ Ro5 ✓ Clean N[C@H](C/C=C/C[C@@H](N)C(=O)O)C(=O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.