Target candidate with partial support; inspect missing evidence before prioritizing.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 37.209 Lower values reduce human off-target concern.
- Human E-value
- 8.45e-11
- Gut microbiome similarity
- 3.3% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 0.0 Higher values support similarity to known essential genes.
Localization
- Localization
- CytoplasmicMembrane
Structure confidence
- ColabFold pLDDT
- 96.64 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelThe selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.
Sequence
Sequence
Primary amino-acid sequence viewer.
MAEMKNLKVEVVRYNPEVDTAPHSAFYDVPYDEQTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNKVPKLACKTFLRDYTKGIKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNNRTPDQGPNKQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNGQNGVWTCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Enzyme Commission (EC)
1Gene Ontology (GO)
11- GO:0016491 Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
- GO:0009055 A molecular function representing the directed movement of electrons from one molecular entity to another, typically mediated by electron carriers or acceptors, resulting in the transfer of energy and/or the reduction-oxidation (redox) transformation of chemical species. This activity is fundamental to various biological processes, including cellular respiration and photosynthesis, as well as numerous enzymatic reactions involved in metabolic pathways.
- GO:0051536 Binding to an iron-sulfur cluster, a combination of iron and sulfur atoms.
- GO:0006099 A nearly universal metabolic pathway in which the acetyl group of acetyl coenzyme A is effectively oxidized to two CO2 and four pairs of electrons are transferred to coenzymes. The acetyl group combines with oxaloacetate to form citrate, which undergoes successive transformations to isocitrate, 2-oxoglutarate, succinyl-CoA, succinate, fumarate, malate, and oxaloacetate again, thus completing the cycle. In eukaryotes the tricarboxylic acid is confined to the mitochondria. See also glyoxylate cycle.
- GO:0051537 Binding to a 2 iron, 2 sulfur (2Fe-2S) cluster; this cluster consists of two iron atoms, with two inorganic sulfur atoms found between the irons and acting as bridging ligands.
- GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
- GO:0051538 Binding to a 3 iron, 4 sulfur (3Fe-4S) cluster; this cluster consists of three iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands. It is essentially a 4Fe-4S cluster with one iron missing.
- GO:0051539 Binding to a 4 iron, 4 sulfur (4Fe-4S) cluster; this cluster consists of four iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands.
- GO:0046872 Binding to a metal ion.
- GO:0008177 Catalysis of the reaction: a quinone + succinate = a quinol + fumarate.
- GO:0009061 The enzymatic release of energy from inorganic and organic compounds (especially carbohydrates and fats) which uses compounds other than oxygen (e.g. nitrate, sulfate) as the terminal electron acceptor.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 11 | 229 | NCBIfam | TIGR00384 | succinate dehydrogenase and fumarate reductase iron-sulfur protein |
| 11 | 229 | InterPro | IPR004489 | Succinate dehydrogenase/fumarate reductase iron-sulphur protein |
| 58 | 66 | ProSitePatterns | PS00197 | 2Fe-2S ferredoxin-type iron-sulfur binding region signature. |
| 58 | 66 | InterPro | IPR006058 | 2Fe-2S ferredoxin, iron-sulphur binding site |
| 146 | 219 | Pfam | PF13183 | 4Fe-4S dicluster domain |
| 146 | 219 | InterPro | IPR017896 | 4Fe-4S ferredoxin-type, iron-sulphur binding domain |
| 3 | 106 | FunFam | G3DSA:3.10.20.30:FF:000009 | Succinate dehydrogenase iron-sulfur subunit |
| 8 | 111 | Pfam | PF13085 | 2Fe-2S iron-sulfur cluster binding domain |
| 8 | 111 | InterPro | IPR025192 | Succinate dehydogenase/fumarate reductase N-terminal |
| 23 | 243 | PANTHER | PTHR43551 | FUMARATE REDUCTASE IRON-SULFUR SUBUNIT |
| 149 | 160 | ProSitePatterns | PS00198 | 4Fe-4S ferredoxin-type iron-sulfur binding region signature. |
| 149 | 160 | InterPro | IPR017900 | 4Fe-4S ferredoxin, iron-sulphur binding, conserved site |
| 107 | 229 | SUPERFAMILY | SSF46548 | alpha-helical ferredoxin |
| 140 | 169 | ProSiteProfiles | PS51379 | 4Fe-4S ferredoxin-type iron-sulfur binding domain profile. |
| 140 | 169 | InterPro | IPR017896 | 4Fe-4S ferredoxin-type, iron-sulphur binding domain |
| 7 | 97 | ProSiteProfiles | PS51085 | 2Fe-2S ferredoxin-type iron-sulfur binding domain profile. |
| 7 | 97 | InterPro | IPR001041 | 2Fe-2S ferredoxin-type iron-sulfur binding domain |
| 3 | 106 | Gene3D | G3DSA:3.10.20.30 | - |
| 3 | 106 | InterPro | IPR012675 | Beta-grasp domain superfamily |
| 107 | 244 | FunFam | G3DSA:1.10.1060.10:FF:000002 | Succinate dehydrogenase iron-sulfur subunit |
| 107 | 244 | Gene3D | G3DSA:1.10.1060.10 | - |
| 107 | 244 | InterPro | IPR009051 | Alpha-helical ferredoxin |
| 4 | 106 | SUPERFAMILY | SSF54292 | 2Fe-2S ferredoxin-like |
| 4 | 106 | InterPro | IPR036010 | 2Fe-2S ferredoxin-like superfamily |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · FPocket
Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · P2Rank
Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GM87
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_00513
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 11J RCSB PDB | Q007T0 | 399.2 Da LogP 5.21 TPSA 29.1 | 1 viol. | ✓ Clean |
c1ccc(cc1)c2cccc(c2)NC(=O)c3ccccc3I
|
|
| 12J RCSB PDB | O44074 | 381.2 Da LogP 4.33 TPSA 38.3 | ✓ Ro5 | ✓ Clean |
CC(C)Oc1cccc(c1)NC(=O)c2ccccc2I
|
|
| 3NP RCSB PDB | P0AC47 | 119.1 Da LogP -0.26 TPSA 80.4 | ✓ Ro5 | ✓ Clean |
C(C[N+](=O)[O-])C(=O)O
|
|
| 3PE RCSB PDB | Q9YHT2 | 748.1 Da LogP 12.06 TPSA 134.4 | 2 viol. | ✓ Clean |
CCCCCCCCCCCCCCCCCC(=O)OC[C@H](COP(=O)(O)OCCN)OC…
|
|
| 4YP RCSB PDB | O44074 | 303.4 Da LogP 3.35 TPSA 69.4 | ✓ Ro5 | Alert |
CC1=C(C(=O)C(=C(C1=O)N)OC)C/C=C(\C)/CCC=C(C)C
|
|
| AT5 RCSB PDB | Q007T0 | 366.2 Da LogP 2.79 TPSA 88.6 | ✓ Ro5 | ✓ Clean |
C[C@@H](C[C@H](C)C(=O)C1=C(C(=C(NC1=O)OC)OC)O)[…
|
|
| BOL RCSB PDB | Q007T0 | 323.1 Da LogP 3.54 TPSA 29.1 | ✓ Ro5 | ✓ Clean |
c1ccc(cc1)NC(=O)c2ccccc2I
|
|
| BRS RCSB PDB | P0AC47 | 322.7 Da LogP 4.01 TPSA 106.5 | ✓ Ro5 | ✓ Clean |
C[C@H](c1ccc(cc1)Cl)c2cc(cc(c2O)[N+](=O)[O-])[N…
|
|
| CBE RCSB PDB | P07014 | 235.3 Da LogP 2.62 TPSA 38.3 | ✓ Ro5 | ✓ Clean |
CC1=C(SCCO1)C(=O)Nc2ccccc2
|
|
| CDN RCSB PDB | P07014 | 1151.5 Da LogP 14.77 TPSA 249.6 | 4 viol. | ✓ Clean |
CCCCCCCCCCCCCCC(O)O[C@H](COC(CCCCC)O)CO[P@@](=O…
|
|
| CE1 RCSB PDB | P0AC47 | 538.8 Da LogP 4.03 TPSA 94.1 | 1 viol. | ✓ Clean |
CCCCCCCCCCCCOCCOCCOCCOCCOCCOCCOCCOCCO
|
|
| DMW RCSB PDB | P17596 | 186.2 Da LogP 2.40 TPSA 34.1 | ✓ Ro5 | Alert |
CC1=C(C(=O)c2ccccc2C1=O)C
|
|
| DNT RCSB PDB | P07014 | 282.3 Da LogP 3.89 TPSA 106.5 | ✓ Ro5 | ✓ Clean |
CCCCCC(C)c1cc(cc(c1O)[N+](=O)[O-])[N+](=O)[O-]
|
|
| E23 RCSB PDB | Q007T0 | 335.4 Da LogP 4.93 TPSA 29.1 | ✓ Ro5 | ✓ Clean |
CC(C)(C)c1ccc(cc1)CNC(=O)c2ccccc2C(F)(F)F
|
|
| E24 RCSB PDB | O44074 | 348.2 Da LogP 4.94 TPSA 29.1 | ✓ Ro5 | ✓ Clean |
c1ccc(c(c1)C(=O)NCc2ccc(cc2Cl)Cl)C(F)(F)F
|
|
| EBM RCSB PDB | Q007T0 | 289.1 Da LogP 2.43 TPSA 29.1 | ✓ Ro5 | ✓ Clean |
CC(C)NC(=O)c1ccccc1I
|
|
| EPH RCSB PDB | Q007T0 | 709.9 Da LogP 10.16 TPSA 134.4 | 2 viol. | ✓ Clean |
CCCC=CCC=CCCCCCCCC(=O)O[C@H](COC(=O)CCCCCCC=CCC…
|
|
| F3S RCSB PDB | P0AC47 | 295.8 Da LogP 2.59 TPSA 0.0 | ✓ Ro5 | ✓ Clean |
S1[Fe]2S[Fe]3[S]2[Fe]1S3
|
|
| F6A RCSB PDB | Q007T0 | 341.3 Da LogP 5.62 TPSA 29.1 | 1 viol. | ✓ Clean |
c1ccc(cc1)c2cccc(c2)NC(=O)c3ccccc3C(F)(F)F
|
|
| F7A RCSB PDB | Q007T0 | 357.3 Da LogP 5.75 TPSA 38.3 | 1 viol. | ✓ Clean |
c1ccc(cc1)Oc2cccc(c2)NC(=O)c3ccccc3C(F)(F)F
|
|
| F9A RCSB PDB | Q007T0 | 322.3 Da LogP 4.02 TPSA 32.3 | ✓ Ro5 | ✓ Clean |
CN(C)Cc1cccc(c1)NC(=O)c2ccccc2C(F)(F)F
|
|
| FD8 RCSB PDB | Q007T0 | 447.3 Da LogP 6.45 TPSA 38.3 | 1 viol. | ✓ Clean |
c1ccc(c(c1)C(=O)Nc2cccc(c2)Oc3c(c(c(c(c3F)F)F)F…
|
|
| FES RCSB PDB | P0AC47 | 175.8 Da LogP 1.29 TPSA 0.0 | ✓ Ro5 | ✓ Clean |
S1[Fe]S[Fe]1
|
|
| FLC RCSB PDB | P0AC47 | 189.1 Da LogP -5.25 TPSA 140.6 | ✓ Ro5 | ✓ Clean |
C(C(=O)[O-])C(CC(=O)[O-])(C(=O)[O-])O
|
|
| FTN RCSB PDB | Q9YHT2 | 323.3 Da LogP 4.74 TPSA 38.3 | ✓ Ro5 | ✓ Clean |
CC(C)Oc1cccc(c1)NC(=O)c2ccccc2C(F)(F)F
|
|
| FUM RCSB PDB | P0AC47 | 116.1 Da LogP -0.29 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
C(=C/C(=O)O)\C(=O)O
|
|
| GUA RCSB PDB | P0AC47 | 132.1 Da LogP 0.33 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
C(CC(=O)O)CC(=O)O
|
|
| HQO RCSB PDB | P0AC47 | 259.3 Da LogP 3.69 TPSA 47.2 | ✓ Ro5 | Alert |
CCCCCCCc1cc(c2ccccc2[n+]1[O-])O
|
|
| JMP RCSB PDB | Q007T0 | 299.3 Da LogP 3.42 TPSA 75.6 | ✓ Ro5 | ✓ Clean |
CC(C)Oc1cccc(c1)NC(=O)c2ccccc2C(=O)O
|
|
| LMT RCSB PDB | P17596 | 510.6 Da LogP -0.45 TPSA 178.5 | 3 viol. | ✓ Clean |
CCCCCCCCCCCCO[C@H]1[C@@H]([C@H]([C@@H]([C@H](O1…
|
|
| MLA RCSB PDB | P17596 | 104.1 Da LogP -0.45 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
C(C(=O)O)C(=O)O
|
|
| MLI RCSB PDB | Q007T0 | 102.0 Da LogP -3.12 TPSA 80.3 | ✓ Ro5 | ✓ Clean |
C(C(=O)[O-])C(=O)[O-]
|
|
| MQ7 RCSB PDB | P0AC47 | 649.0 Da LogP 14.10 TPSA 34.1 | 2 viol. | Alert |
CC1=C(C(=O)c2ccccc2C1=O)C\C=C(/C)\CC\C=C(/C)\CC…
|
|
| MRN RCSB PDB | Q007T0 | 269.3 Da LogP 4.03 TPSA 38.3 | ✓ Ro5 | ✓ Clean |
Cc1ccccc1C(=O)Nc2cccc(c2)OC(C)C
|
|
| N1M RCSB PDB | Q007T0 | 261.1 Da LogP 1.65 TPSA 29.1 | ✓ Ro5 | ✓ Clean |
CNC(=O)c1ccccc1I
|
|
| NBI RCSB PDB | Q007T0 | 242.2 Da LogP 2.85 TPSA 72.2 | ✓ Ro5 | ✓ Clean |
c1ccc(cc1)NC(=O)c2ccccc2[N+](=O)[O-]
|
|
| OAA RCSB PDB | P0AC47 | 131.1 Da LogP -2.22 TPSA 94.5 | ✓ Ro5 | ✓ Clean |
C(C(=O)C(=O)O)C(=O)[O-]
|
|
| PCI RCSB PDB | Q007T0 | 266.3 Da LogP 4.66 TPSA 20.2 | ✓ Ro5 | ✓ Clean |
c1(c(c(c(c(c1Cl)Cl)Cl)Cl)Cl)O
|
|
| RQX RCSB PDB | O44074 | 263.3 Da LogP 2.41 TPSA 69.4 | ✓ Ro5 | Alert |
CCC/C(=C/CC1=C(C(=O)C(=C(C1=O)OC)N)C)/C
|
|
| SLI RCSB PDB | Q007T0 | 213.2 Da LogP 2.64 TPSA 49.3 | ✓ Ro5 | ✓ Clean |
c1ccc(cc1)NC(=O)c2ccccc2O
|
|
| TEO RCSB PDB | P07014 | 132.1 Da LogP -3.14 TPSA 103.7 | ✓ Ro5 | ✓ Clean |
C(=C(\O)/[O-])\[C@H](C(=O)[O-])O
|
|
| TFZ RCSB PDB | Q007T0 | 265.2 Da LogP 3.96 TPSA 29.1 | ✓ Ro5 | ✓ Clean |
c1ccc(cc1)NC(=O)c2ccccc2C(F)(F)F
|
|
| TMG RCSB PDB | Q007T0 | 201.3 Da LogP 2.69 TPSA 41.6 | ✓ Ro5 | ✓ Clean |
c1ccc2c(c1)[nH]c(n2)c3cscn3
|
|
| TTF RCSB PDB | Q007T0 | 222.2 Da LogP 2.45 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
c1cc(sc1)C(=O)CC(=O)C(F)(F)F
|
|
| UMQ RCSB PDB | Q9YHT2 | 496.6 Da LogP -0.84 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCCCCO[C@H]1[C@@H]([C@H]([C@@H]([C@H](O1)…
|
|
| UQ1 RCSB PDB | Q007T0 | 250.3 Da LogP 2.32 TPSA 52.6 | ✓ Ro5 | Alert |
CC1=C(C(=O)C(=C(C1=O)OC)OC)CC=C(C)C
|
|
| UQ2 RCSB PDB | P07014 | 318.4 Da LogP 4.04 TPSA 52.6 | ✓ Ro5 | Alert |
CC1=C(C(=O)C(=C(C1=O)OC)OC)C\C=C(/C)\CCC=C(C)C
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC100004957 ZINC | 1.000 | 222.2 Da LogP 2.45 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
O=C(CC(=O)C(F)(F)F)c1cccs1
|
| ZINC100014200 ZINC | 1.000 | 494.7 Da LogP 4.02 TPSA 84.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC100053689 ZINC | 1.000 | 482.6 Da LogP -1.23 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCCCO[C@H]1O[C@H](CO)[C@@H](O[C@H]2O[C@H]…
|
| ZINC100070166 ZINC | 1.000 | 290.4 Da LogP 3.17 TPSA 47.9 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCOCCOCCOCCO
|
| ZINC100310628 ZINC | 1.000 | 478.7 Da LogP 4.78 TPSA 75.6 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCOCCOCCOCCOCCOCCOCCO
|
| ZINC100365196 ZINC | 1.000 | 302.5 Da LogP 4.71 TPSA 38.7 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCOCCOCCO
|
| ZINC101772322 ZINC | 1.000 | 434.7 Da LogP 4.76 TPSA 66.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCOCCOCCOCCOCCOCCO
|
| ZINC102190506 ZINC | 1.000 | 467.5 Da LogP 4.25 TPSA 134.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@H](CO[P@@](=O)(O)OCCN)OC(=O)CC…
|
| ZINC102190512 ZINC | 1.000 | 467.5 Da LogP 4.25 TPSA 134.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@@H](CO[P@@](=O)(O)OCCN)OC(=O)C…
|
| ZINC103600921 ZINC | 1.000 | 466.7 Da LogP 3.24 TPSA 84.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC1479 ZINC | 1.000 | 323.3 Da LogP 4.74 TPSA 38.3 | ✓ Ro5 | ✓ Clean |
CC(C)Oc1cccc(NC(=O)c2ccccc2C(F)(F)F)c1
|
| ZINC14880431 ZINC | 1.000 | 378.6 Da LogP 3.20 TPSA 66.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCOCCOCCOCCOCCOCCO
|
| ZINC14881140 ZINC | 1.000 | 306.4 Da LogP 2.41 TPSA 57.2 | ✓ Ro5 | ✓ Clean |
CCCCCCCCOCCOCCOCCOCCO
|
| ZINC1501015302 ZINC | 1.000 | 482.6 Da LogP -1.23 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCCCO[C@@H]1O[C@H](CO)[C@@H](O[C@H]2O[C@H…
|
| ZINC1529909 ZINC | 1.000 | 259.3 Da LogP 3.69 TPSA 47.2 | ✓ Ro5 | Alert |
CCCCCCCc1cc(O)c2ccccc2[n+]1[O-]
|
| ZINC16051619 ZINC | 1.000 | 350.5 Da LogP 2.42 TPSA 66.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCOCCOCCOCCOCCOCCO
|
| ZINC2039285652 ZINC | 1.000 | 454.5 Da LogP -2.01 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCO[C@H]1O[C@H](CO)[C@H](O[C@@H]2O[C@H](C…
|
| ZINC2039285653 ZINC | 1.000 | 454.5 Da LogP -2.01 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCO[C@H]1O[C@H](CO)[C@H](O[C@@H]2O[C@H](C…
|
| ZINC2039285654 ZINC | 1.000 | 454.5 Da LogP -2.01 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCO[C@H]1O[C@H](CO)[C@H](O[C@@H]2O[C@H](C…
|
| ZINC2039285655 ZINC | 1.000 | 454.5 Da LogP -2.01 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCO[C@H]1O[C@H](CO)[C@H](O[C@@H]2O[C@H](C…
|
| ZINC2053493146 ZINC | 1.000 | 482.6 Da LogP -1.23 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCCCO[C@H]1O[C@H](CO)[C@H](O[C@@H]2O[C@H]…
|
| ZINC2053493148 ZINC | 1.000 | 482.6 Da LogP -1.23 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCCCO[C@H]1O[C@H](CO)[C@H](O[C@@H]2O[C@H]…
|
| ZINC2053493149 ZINC | 1.000 | 482.6 Da LogP -1.23 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCCCO[C@H]1O[C@H](CO)[C@H](O[C@@H]2O[C@H]…
|
| ZINC238809245 ZINC | 1.000 | 510.6 Da LogP -0.45 TPSA 178.5 | 3 viol. | ✓ Clean |
CCCCCCCCCCCCO[C@@H]1O[C@H](CO)[C@@H](O[C@H]2O[C…
|
| ZINC252695224 ZINC | 1.000 | 482.6 Da LogP -1.23 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCCCO[C@@H]1O[C@H](CO)[C@@H](O[C@H]2O[C@H…
|
| ZINC252695225 ZINC | 1.000 | 482.6 Da LogP -1.23 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCCCO[C@@H]1O[C@H](CO)[C@@H](O[C@H]2O[C@H…
|
| ZINC252695226 ZINC | 1.000 | 482.6 Da LogP -1.23 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCCCO[C@@H]1O[C@H](CO)[C@@H](O[C@H]2O[C@H…
|
| ZINC2584424 ZINC | 1.000 | 218.3 Da LogP 2.37 TPSA 38.7 | ✓ Ro5 | ✓ Clean |
CCCCCCCCOCCOCCO
|
| ZINC4521877 ZINC | 1.000 | 234.3 Da LogP 1.61 TPSA 47.9 | ✓ Ro5 | ✓ Clean |
CCCCCCOCCOCCOCCO
|
| ZINC5273610 ZINC | 1.000 | 322.4 Da LogP 1.64 TPSA 66.4 | ✓ Ro5 | ✓ Clean |
CCCCCCOCCOCCOCCOCCOCCO
|
| ZINC58538366 ZINC | 1.000 | 392.6 Da LogP 3.59 TPSA 66.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCOCCOCCOCCOCCOCCO
|
| ZINC58631420 ZINC | 1.000 | 422.6 Da LogP 3.22 TPSA 75.6 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCOCCOCCOCCOCCOCCOCCO
|
| ZINC59441819 ZINC | 1.000 | 318.5 Da LogP 3.95 TPSA 47.9 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCOCCOCCOCCO
|
| ZINC59622400 ZINC | 1.000 | 274.4 Da LogP 3.93 TPSA 38.7 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCOCCOCCO
|
| ZINC59978443 ZINC | 1.000 | 454.5 Da LogP -2.01 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCO[C@@H]1O[C@H](CO)[C@@H](O[C@H]2O[C@H](…
|
| ZINC66157001 ZINC | 1.000 | 468.5 Da LogP -1.62 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCCO[C@@H]1O[C@H](CO)[C@@H](O[C@H]2O[C@H]…
|
| ZINC70669940 ZINC | 1.000 | 482.6 Da LogP -1.23 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCCCO[C@@H]1O[C@@H](CO)[C@@H](O[C@H]2O[C@…
|
| ZINC70669941 ZINC | 1.000 | 482.6 Da LogP -1.23 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCCCO[C@@H]1O[C@@H](CO)[C@@H](O[C@H]2O[C@…
|
| ZINC70669942 ZINC | 1.000 | 482.6 Da LogP -1.23 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCCCO[C@@H]1O[C@@H](CO)[C@@H](O[C@H]2O[C@…
|
| ZINC71788551 ZINC | 1.000 | 334.5 Da LogP 3.19 TPSA 57.2 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCOCCOCCOCCOCCO
|
| ZINC71788564 ZINC | 1.000 | 262.4 Da LogP 2.39 TPSA 47.9 | ✓ Ro5 | ✓ Clean |
CCCCCCCCOCCOCCOCCO
|
| ZINC71788567 ZINC | 1.000 | 406.6 Da LogP 3.98 TPSA 66.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCOCCOCCOCCOCCOCCO
|
| ZINC77311968 ZINC | 1.000 | 454.5 Da LogP -2.01 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCO[C@@H]1O[C@H](CO)[C@@H](O[C@@H]2O[C@H]…
|
| ZINC8214594 ZINC | 1.000 | 362.6 Da LogP 3.97 TPSA 57.2 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCOCCOCCOCCOCCO
|
| ZINC83433913 ZINC | 1.000 | 426.5 Da LogP -2.79 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCO[C@@H]1O[C@H](CO)[C@@H](O[C@H]2O[C@H](CO…
|
| ZINC85482724 ZINC | 1.000 | 482.6 Da LogP -1.23 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCCCO[C@@H]1O[C@H](CO)[C@@H](O[C@H]2O[C@H…
|
| ZINC86002923 ZINC | 1.000 | 426.5 Da LogP -2.79 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCO[C@@H]1O[C@H](CO)[C@H](O[C@H]2O[C@H](CO)…
|
| ZINC88260008 ZINC | 1.000 | 390.6 Da LogP 4.75 TPSA 57.2 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCOCCOCCOCCOCCO
|
| ZINC95784968 ZINC | 1.000 | 450.7 Da LogP 4.00 TPSA 75.6 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCOCCOCCOCCOCCOCCOCCO
|
| ZINC95863931 ZINC | 1.000 | 464.7 Da LogP 4.39 TPSA 75.6 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCOCCOCCOCCOCCOCCOCCO
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.