KpKP13 Protein target profile

Aspartate ammonia-lyase

Accession: KP13_00488

Gene: AHE46777.1 aspA 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GM66
Length 478
Pocket druggability (P2Rank · AlphaFold DB model) 0.071
Direct ligand evidence 0 58 total records
Functional annotation 0 EC 5 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
42.857 Lower values reduce human off-target concern.
Human E-value
2.13e-27
Gut microbiome similarity
12.2% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
77.612 Higher values support similarity to known essential genes.
DEG E-value
0.0 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
95.73 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.071
Structure A0A0H3GM66
Pocket Pocket 1
Druggability (FPocket) 0.346
Structure A0A0H3GM66
Pocket Pocket 1
ColabFold model
P2Rank 0.094 · Pocket 1
FPocket 0.236 · Pocket 5
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 580 / 4744 genomes with a hit
Prevalence 12.2%

Sequence

Primary amino-acid sequence viewer.

MLNNIRIEEDLLGTREVPADAYYGVHTLRAIENFYISNSKISDIPEFVRGMVMVKKAAALANKELQTIPKSAANAIIAACDEVLNNGKCMDQFPVDVFQGGAGTSVNMNTNEVLANIGLELMGHQKGEYQYLNPNDHVNKCQSTNDAYPTGFRIAVYASILKLIDAIKQLGEGFQAKAVEFQDILKMGRTQLQDAVPMTLGQEFHAFNVLLNEETKSILRTAELLLEVNLGATAIGTRLNTPDGYQQLAVQKLAEVSNLPVVPAEDLIEATSDCGAYVMVHSSLKRLAVKLSKICNDLRLLSSGPRAGLNEINLPELQAGSSIMPAKVNPVVPEVVNQVCFKVIGNDTTVTMASEAGQLQLNVMEPVIGQAMFESIHILTNACYNLLEKCVNGITANKAVCEGYVYNSIGIVTYLNPFIGHHNGDIVGKICAETGKSVREVVLERGLLTAAELDDIFSAQNLMHPAYKAKRYTDESEQ

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

5 GO

Subcellular localization

Localization
Cytoplasmic

Gene Ontology (GO)

5
  • GO:0003824 Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
  • GO:0006531 The chemical reactions and pathways involving aspartate, the anion derived from aspartic acid, 2-aminobutanedioic acid.
  • GO:0006099 A nearly universal metabolic pathway in which the acetyl group of acetyl coenzyme A is effectively oxidized to two CO2 and four pairs of electrons are transferred to coenzymes. The acetyl group combines with oxaloacetate to form citrate, which undergoes successive transformations to isocitrate, 2-oxoglutarate, succinyl-CoA, succinate, fumarate, malate, and oxaloacetate again, thus completing the cycle. In eukaryotes the tricarboxylic acid is confined to the mitochondria. See also glyoxylate cycle.
  • GO:0016829 Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
  • GO:0008797 Catalysis of the reaction: L-aspartate = fumarate + NH4+.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

30 records
Show feature table
Start End DB Term Name
6 458 CDD cd01357 Aspartase
137 159 PRINTS PR00145 Argininosuccinate lyase family signature
320 336 PRINTS PR00145 Argininosuccinate lyase family signature
178 198 PRINTS PR00145 Argininosuccinate lyase family signature
143 409 FunFam G3DSA:1.20.200.10:FF:000001 Fumarate hydratase, mitochondrial
320 329 ProSitePatterns PS00163 Fumarate lyases signature.
320 329 InterPro IPR020557 Fumarate lyase, conserved site
6 142 Gene3D G3DSA:1.10.275.10 -
6 142 InterPro IPR024083 Fumarase/histidase, N-terminal
320 336 PRINTS PR00149 Fumarate lyase superfamily signature
320 336 InterPro IPR000362 Fumarate lyase family
183 201 PRINTS PR00149 Fumarate lyase superfamily signature
183 201 InterPro IPR000362 Fumarate lyase family
138 156 PRINTS PR00149 Fumarate lyase superfamily signature
138 156 InterPro IPR000362 Fumarate lyase family
274 301 PRINTS PR00149 Fumarate lyase superfamily signature
274 301 InterPro IPR000362 Fumarate lyase family
1 458 SUPERFAMILY SSF48557 L-aspartase-like
1 458 InterPro IPR008948 L-Aspartase-like
6 474 NCBIfam TIGR00839 aspartate ammonia-lyase
6 474 InterPro IPR004708 Aspartate ammonia-lyase
143 410 Gene3D G3DSA:1.20.200.10 Fumarase/aspartase (Central domain)
411 464 Pfam PF10415 Fumarase C C-terminus
411 464 InterPro IPR018951 Fumarase C, C-terminal
13 345 Pfam PF00206 Lyase
13 345 InterPro IPR022761 Fumarate lyase, N-terminal
6 142 FunFam G3DSA:1.10.275.10:FF:000001 Fumarate hydratase, mitochondrial
411 460 FunFam G3DSA:1.10.40.30:FF:000003 Aspartate ammonia-lyase
411 459 Gene3D G3DSA:1.10.40.30 -
4 472 PANTHER PTHR42696 ASPARTATE AMMONIA-LYASE

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.071
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.065
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.039
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.02
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #1
0.346 Unusual size
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GM66
AlphaFold DB full sequence Viewing
ColabFold KP13_00488
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

58 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 8 records from similar proteins
Structural ligands 8 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
APO PDB via homolog 169.1 Da · LogP -1.42 · TPSA 120.8 Open detail RCSB PDB
FLC PDB via homolog Detail RCSB PDB
FUM PDB via homolog Detail RCSB PDB
LMR PDB via homolog Detail RCSB PDB
MLT PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
APO RCSB PDB P07954 169.1 Da LogP -1.42 TPSA 120.8 ✓ Ro5 ✓ Clean C([C@H](C(=O)O)N)P(=O)(O)O
FLC RCSB PDB P05042 189.1 Da LogP -5.25 TPSA 140.6 ✓ Ro5 ✓ Clean C(C(=O)[O-])C(CC(=O)[O-])(C(=O)[O-])O
FUM RCSB PDB A0A077EBQ3 116.1 Da LogP -0.29 TPSA 74.6 ✓ Ro5 ✓ Clean C(=C/C(=O)O)\C(=O)O
LMR RCSB PDB Q65UJ3 134.1 Da LogP -1.09 TPSA 94.8 ✓ Ro5 ✓ Clean C([C@@H](C(=O)O)O)C(=O)O
MLT RCSB PDB P05042 134.1 Da LogP -1.09 TPSA 94.8 ✓ Ro5 ✓ Clean C([C@H](C(=O)O)O)C(=O)O
PMA RCSB PDB P05042 254.1 Da LogP 0.48 TPSA 149.2 ✓ Ro5 ✓ Clean c1c(c(cc(c1C(=O)O)C(=O)O)C(=O)O)C(=O)O
SIF RCSB PDB P05042 190.3 Da LogP 1.25 TPSA 74.6 ✓ Ro5 ✓ Clean C[Si](C)(C)C(CC(=O)O)C(=O)O
TLA RCSB PDB P07954 150.1 Da LogP -2.12 TPSA 115.1 ✓ Ro5 ✓ Clean [C@@H]([C@H](C(=O)O)O)(C(=O)O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.