Target candidate with partial support; inspect missing evidence before prioritizing.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 40.541 Lower values reduce human off-target concern.
- Human E-value
- 8.45e-16
- Gut microbiome similarity
- 2.0% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 0.0 Higher values support similarity to known essential genes.
Localization
- Localization
- Cytoplasmic
Structure confidence
- ColabFold pLDDT
- 96.33 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelThe selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.
Sequence
Sequence
Primary amino-acid sequence viewer.
MMTTPDAVVVLCTAPDEATAQDLAAKALAEKVAACATLLPGATSLYYWEGKLEQEYEVQMLLKTDLAHQQALLDCLKSHHPYQTPELLVLPVTHGDNDYLSWLTASLR
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
3- GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
- GO:0005507 Binding to a copper (Cu) ion.
- GO:0010038 Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a metal ion stimulus.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 1 | 6 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. |
| 1 | 20 | Phobius | SIGNAL_PEPTIDE | Signal peptide region |
| 2 | 108 | Hamap | MF_01160 | Divalent-cation tolerance protein CutA [cutA]. |
| 2 | 108 | InterPro | IPR023700 | Divalent cation tolerance protein CutA, Enterobacteria |
| 7 | 14 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. |
| 4 | 107 | SUPERFAMILY | SSF54913 | GlnB-like |
| 4 | 107 | InterPro | IPR011322 | Nitrogen regulatory PII-like, alpha/beta |
| 21 | 108 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 8 | 105 | Pfam | PF03091 | CutA1 divalent ion tolerance protein |
| 8 | 105 | InterPro | IPR004323 | Divalent ion tolerance protein, CutA |
| 6 | 107 | PANTHER | PTHR23419 | DIVALENT CATION TOLERANCE CUTA-RELATED |
| 6 | 107 | InterPro | IPR004323 | Divalent ion tolerance protein, CutA |
| 15 | 20 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. |
| 1 | 108 | Gene3D | G3DSA:3.30.70.120 | - |
| 1 | 108 | InterPro | IPR015867 | Nitrogen regulatory protein PII/ATP phosphoribosyltransferase, C-terminal |
| 1 | 108 | FunFam | G3DSA:3.30.70.120:FF:000004 | Divalent-cation tolerance protein CutA |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Residue sets
Binding pockets · P2Rank
Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GH55
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_00486
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC1615342 ZINC | 1.000 | 209.2 Da LogP -3.01 TPSA 104.4 | ✓ Ro5 | ✓ Clean |
OCCN(CCO)C(CO)(CO)CO
|
| ZINC114185151 ZINC | 0.632 | 298.2 Da LogP 2.15 TPSA 108.7 | ✓ Ro5 | Alert |
O=C(O)c1ccc(C(=O)C(=O)c2ccc(C(=O)O)cc2)cc1
|
| ZINC134079 ZINC | 0.600 | 242.2 Da LogP 2.75 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(-c2ccc(C(=O)O)cc2)cc1
|
| ZINC1640789 ZINC | 0.600 | 374.3 Da LogP 3.55 TPSA 108.7 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(C(=O)c2ccc(C(=O)c3ccc(C(=O)O)cc3)cc…
|
| ZINC2146859 ZINC | 0.600 | 270.2 Da LogP 2.31 TPSA 91.7 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(C(=O)c2ccc(C(=O)O)cc2)cc1
|
| ZINC3147211 ZINC | 0.600 | 318.3 Da LogP 4.42 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(-c2ccc(-c3ccc(C(=O)O)cc3)cc2)cc1
|
| ZINC188555 ZINC | 0.591 | 350.3 Da LogP 4.67 TPSA 93.1 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(Oc2ccc(Oc3ccc(C(=O)O)cc3)cc2)cc1
|
| ZINC241160 ZINC | 0.591 | 258.2 Da LogP 2.88 TPSA 83.8 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(Oc2ccc(C(=O)O)cc2)cc1
|
| ZINC389804 ZINC | 0.565 | 214.2 Da LogP 2.76 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(-c2ccc(O)cc2)cc1
|
| ZINC392302 ZINC | 0.560 | 230.2 Da LogP 2.88 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(Oc2ccc(O)cc2)cc1
|
| ZINC167246 ZINC | 0.545 | 248.0 Da LogP 1.99 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(I)cc1
|
| ZINC3269660 ZINC | 0.545 | 254.2 Da LogP 2.45 TPSA 71.4 | ✓ Ro5 | Alert |
O=C(O)c1ccc(C(=O)C(=O)c2ccccc2)cc1
|
| ZINC34573580 ZINC | 0.545 | 496.5 Da LogP 4.86 TPSA 149.2 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(C(c2ccc(C(=O)O)cc2)(c2ccc(C(=O)O)cc…
|
| ZINC388063 ZINC | 0.545 | 201.0 Da LogP 2.15 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(Br)cc1
|
| ZINC13375284 ZINC | 0.522 | 270.2 Da LogP 3.50 TPSA 99.3 | ✓ Ro5 | Alert |
O=C(O)c1ccc(N=Nc2ccc(C(=O)O)cc2)cc1
|
| ZINC156520 ZINC | 0.522 | 268.3 Da LogP 3.25 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(/C=C/c2ccc(C(=O)O)cc2)cc1
|
| ZINC1651850 ZINC | 0.522 | 270.3 Da LogP 2.87 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(CCc2ccc(C(=O)O)cc2)cc1
|
| ZINC1759946 ZINC | 0.522 | 256.3 Da LogP 2.67 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(Cc2ccc(C(=O)O)cc2)cc1
|
| ZINC1857524265 ZINC | 0.522 | 268.3 Da LogP 3.25 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(C=Cc2ccc(C(=O)O)cc2)cc1
|
| ZINC2334905 ZINC | 0.522 | 261.4 Da LogP 1.10 TPSA 63.9 | ✓ Ro5 | ✓ Clean |
CC(C)CCN(CCC(C)C)C(CO)(CO)CO
|
| ZINC2504355 ZINC | 0.522 | 226.2 Da LogP 2.62 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(C(=O)c2ccccc2)cc1
|
| ZINC3159953 ZINC | 0.522 | 261.4 Da LogP 1.38 TPSA 63.9 | ✓ Ro5 | ✓ Clean |
CCCCCN(CCCCC)C(CO)(CO)CO
|
| ZINC32299177 ZINC | 0.522 | 266.3 Da LogP 2.48 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(C#Cc2ccc(C(=O)O)cc2)cc1
|
| ZINC34009333 ZINC | 0.522 | 376.4 Da LogP 3.96 TPSA 111.9 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(C(c2ccc(C(=O)O)cc2)c2ccc(C(=O)O)cc2…
|
| ZINC34057267 ZINC | 0.522 | 274.3 Da LogP 4.72 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(-c2ccc(-c3ccccc3)cc2)cc1
|
| ZINC346855 ZINC | 0.522 | 274.3 Da LogP 3.23 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(Sc2ccc(C(=O)O)cc2)cc1
|
| ZINC4309722 ZINC | 0.522 | 270.2 Da LogP 3.50 TPSA 99.3 | ✓ Ro5 | Alert |
O=C(O)c1ccc(/N=N/c2ccc(C(=O)O)cc2)cc1
|
| ZINC4792283 ZINC | 0.522 | 268.3 Da LogP 3.25 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(/C=C\c2ccc(C(=O)O)cc2)cc1
|
| ZINC59301968 ZINC | 0.522 | 394.3 Da LogP 2.54 TPSA 111.9 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(P(c2ccc(C(=O)O)cc2)c2ccc(C(=O)O)cc2…
|
| ZINC8418684 ZINC | 0.522 | 257.2 Da LogP 2.83 TPSA 86.6 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(Nc2ccc(C(=O)O)cc2)cc1
|
| ZINC95080304 ZINC | 0.522 | 377.4 Da LogP 4.25 TPSA 115.1 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(N(c2ccc(C(=O)O)cc2)c2ccc(C(=O)O)cc2…
|
| ZINC96024941 ZINC | 0.522 | 366.4 Da LogP 3.88 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(C#Cc2ccc(C#Cc3ccc(C(=O)O)cc3)cc2)cc1
|
| ZINC112963478 ZINC | 0.520 | 358.3 Da LogP 2.10 TPSA 127.2 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(C(=O)OCCOC(=O)c2ccc(C(=O)O)cc2)cc1
|
| ZINC2163682 ZINC | 0.520 | 302.3 Da LogP 2.54 TPSA 93.1 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(OCCOc2ccc(C(=O)O)cc2)cc1
|
| ZINC263618653 ZINC | 0.520 | 302.2 Da LogP 2.82 TPSA 117.8 | ✓ Ro5 | Alert |
O=C(O)c1ccc(O/N=N/Oc2ccc(C(=O)O)cc2)cc1
|
| ZINC3150492 ZINC | 0.520 | 406.3 Da LogP 3.52 TPSA 127.2 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(OC(=O)c2ccc(C(=O)Oc3ccc(C(=O)O)cc3)…
|
| ZINC60939 ZINC | 0.520 | 214.2 Da LogP 3.18 TPSA 46.5 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(Oc2ccccc2)cc1
|
| ZINC642881183 ZINC | 0.520 | 350.3 Da LogP 3.83 TPSA 115.1 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(-c2cc(O)c(-c3ccc(C(=O)O)cc3)cc2O)cc1
|
| ZINC754399 ZINC | 0.520 | 362.3 Da LogP 4.11 TPSA 100.9 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(Oc2ccc(C(=O)c3ccc(C(=O)O)cc3)cc2)cc1
|
| ZINC1594026 ZINC | 0.500 | 284.3 Da LogP 3.41 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
CC(C)(c1ccc(C(=O)O)cc1)c1ccc(C(=O)O)cc1
|
| ZINC166414480 ZINC | 0.500 | 322.3 Da LogP 2.00 TPSA 126.2 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(-c2nnc(-c3ccc(C(=O)O)cc3)nn2)cc1
|
| ZINC1728705 ZINC | 0.500 | 239.5 Da LogP 3.21 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(C(Cl)(Cl)Cl)cc1
|
| ZINC1846432 ZINC | 0.500 | 316.3 Da LogP 2.93 TPSA 93.1 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(OCCCOc2ccc(C(=O)O)cc2)cc1
|
| ZINC195408276 ZINC | 0.500 | 300.4 Da LogP 1.91 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
C[Si](C)(c1ccc(C(=O)O)cc1)c1ccc(C(=O)O)cc1
|
| ZINC2528579 ZINC | 0.500 | 441.4 Da LogP 3.97 TPSA 150.6 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(-c2nc(-c3ccc(C(=O)O)cc3)nc(-c3ccc(C…
|
| ZINC3129995 ZINC | 0.500 | 446.5 Da LogP 2.75 TPSA 142.9 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(S(=O)(=O)c2ccc(S(=O)(=O)c3ccc(C(=O)…
|
| ZINC32189977 ZINC | 0.500 | 272.3 Da LogP 2.16 TPSA 94.8 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(C(O)c2ccc(C(=O)O)cc2)cc1
|
| ZINC33246180 ZINC | 0.500 | 242.2 Da LogP 3.51 TPSA 82.2 | ✓ Ro5 | Alert |
O=C(O)c1ccc(N=Nc2ccc(O)cc2)cc1
|
| ZINC348142 ZINC | 0.500 | 306.3 Da LogP 1.92 TPSA 108.7 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(S(=O)(=O)c2ccc(C(=O)O)cc2)cc1
|
| ZINC5580842 ZINC | 0.500 | 316.3 Da LogP 2.89 TPSA 98.7 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(NC(=S)Nc2ccc(C(=O)O)cc2)cc1
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.