KpKP13 Protein target profile

Biofilm PGA synthesis lipoprotein pgaB

Accession: KP13_00473

Gene: pgaB AHE46793.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GL72

Export view

Length 673

Pocket druggability (P2Rank · AlphaFold DB model) 0.911

Direct ligand evidence 0 51 total records

Functional annotation 0 EC 3 GO

Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Main supporting evidence

Risks to review

Evidence gaps

No metabolic context No SBML/network-derived reaction evidence is loaded for this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target: No hit
Gut microbiome similarity: 1.1% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG): Y
DEG identity (%): 52.906 Higher values support similarity to known essential genes.
DEG E-value: 0.0 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT: 93.84 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.911

Structure A0A0H3GL72

Pocket Pocket 1

Druggability (FPocket) 0.508

Structure A0A0H3GL72

Pocket Pocket 39

ColabFold model

P2Rank 0.909 · Pocket 1

FPocket 0.83 · Pocket 46

Core conservation Conserved core gene

Roary core

CoreCruncher core

Gut microbiome 51 / 4744 genomes with a hit

Prevalence 1.1%

Sequence

Primary amino-acid sequence viewer.

MTMLNTTLRNGLMLLIWLCLIFSVRAEEVPFLAPQQRPQLEANQPWPADRFLVLAYHDVEDDAADQRYLSVRTSALNEQIAWLLHNGYHAISVQDILDAHYGLKSLPPKAFLLSFDDGYSSFYTRVWPLLKAWNVPALWAPVGSWVDTPAGQPVNFGGLMTPRERFATWEMVRELSRSPLVEIGAHTWASHYGLPANPQGSREPAAANRGWDKTTGRYESDAQFTRRMTDDVQKVTAKIHEVAGKTPRAWVWPYGAASGSTLAIAKQQGYQLAFTLNDGLGNVKDLDNIPRLLIAGNPSLKAFASAVTQIQEADPVRVMHVDLDYVYDPNPVQQAKNIDKLVQRVYDMKISHVFLQAFSDPQGDGTVKSLYFPNRWLPMRADLFNFVSWQLQTRGNVKVYAWMPVLAFDLASDLPRVQRWDPQTGKALLARQPYVRLSPWDPRVRQQITDIYEDLARHASFSGILFHDDAVLTDFEDVSPEAVAAWRQTGMAHDADPVPQRPQERQAWMRFKSQTLTRFTLDLRQAVQAIRGPQVKTARNLFALPILEPQSEAWFAQNLDDFLAAYDWTVPMAMPLMESVPIDASQAWLTRLVQAVARHPGALKKTIFELQARDWNRRQQNAIPDQQLADWMRLLRLNGVKNYGYYPDDFINNQPDISRIRPQFSSWWYPDHD

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Subcellular localization

Localization: Periplasmic

Gene Ontology (GO)

GO:0005975 The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y.
GO:0043708 The attachment of a cell to a solid substrate, via cell adhesion molecules, contributing to the formation of a biofilm.
GO:0016810 Catalysis of the hydrolysis of any carbon-nitrogen bond, C-N, with the exception of peptide bonds.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

19 records

Show feature table

Start	End	DB	Term	Name
26	324	PANTHER	PTHR34216	-
27	673	Phobius	NON_CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
105	272	Pfam	PF01522	Polysaccharide deacetylase
105	272	InterPro	IPR002509	NodB homology domain
23	26	Phobius	SIGNAL_PEPTIDE_C_REGION	C-terminal region of a signal peptide.
1	26	SignalP_EUK	SignalP-noTM	SignalP-noTM
1	10	Phobius	SIGNAL_PEPTIDE_N_REGION	N-terminal region of a signal peptide.
311	673	Gene3D	G3DSA:3.20.20.80	Glycosidases
50	666	NCBIfam	TIGR03938	poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB
50	666	InterPro	IPR023854	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB
1	26	Phobius	SIGNAL_PEPTIDE	Signal peptide region
11	22	Phobius	SIGNAL_PEPTIDE_H_REGION	Hydrophobic region of a signal peptide.
320	646	Pfam	PF14883	Hypothetical glycosyl hydrolase family 13
320	646	InterPro	IPR032772	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, C-terminal
109	351	ProSiteProfiles	PS51677	NodB homology domain profile.
109	351	InterPro	IPR002509	NodB homology domain
68	307	SUPERFAMILY	SSF88713	Glycoside hydrolase/deacetylase
68	307	InterPro	IPR011330	Glycoside hydrolase/deacetylase, beta/alpha-barrel
44	310	Gene3D	G3DSA:3.20.20.370	Glycoside hydrolase/deacetylase

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low

How colors and pocket overlays are used

Uniform protein color marks the displayed model as a single molecular object.

Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.

Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.

'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.

'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.

'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.

Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1

0.911

Show in viewer

Surrounding area

Pocket 2 P2Rank #2

0.549

Show in viewer

Surrounding area

Pocket 3 P2Rank #3

0.447

Show in viewer

Surrounding area

Pocket 4 P2Rank #4

0.219

Show in viewer

Surrounding area

Pocket 5 P2Rank #5

0.09

Show in viewer

Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #39

0.508 Unusual size

Show in viewer

Surrounding area

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1

0.909

Show in viewer

Surrounding area

Pocket 2 P2Rank #2

0.566

Show in viewer

Surrounding area

Pocket 3 P2Rank #3

0.548

Show in viewer

Surrounding area

Pocket 4 P2Rank #4

0.291

Show in viewer

Surrounding area

Pocket 5 P2Rank #5

0.063

Show in viewer

Surrounding area

All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold DB AF_A0A0H3GL72	AlphaFold DB	—	—	full sequence	—	Viewing
ColabFold KP13_00473	ColabFold	—	—	full sequence	—	Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

51 records

Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records

Transferred evidence 1 records from similar proteins

Structural ligands 1 0 loaded crystals

Measured bioactivity 0 direct and transferred ChEMBL records

Proposed compounds 50 similarity-based ZINC candidates

Best available ligand signal

GCS PDB via homolog 179.2 Da · LogP -3.25 · TPSA 116.2 Open detail RCSB PDB

ZINC2060993438 ZINC proposed compound · Tanimoto 0.656 Detail ZINC

ZINC2060993439 ZINC proposed compound · Tanimoto 0.656 Detail ZINC

ZINC2060993440 ZINC proposed compound · Tanimoto 0.656 Detail ZINC

ZINC2060993441 ZINC proposed compound · Tanimoto 0.656 Detail ZINC

Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.

No PDB structure with a co-crystallized ligand found for this exact protein.

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Ligand	Source crystal	UniProt (homolog)	MW · LogP · TPSA	Lipinski	PAINS	SMILES
GCS RCSB PDB	4P7N	P75906	179.2 Da LogP -3.25 TPSA 116.2	✓ Ro5	✓ Clean	`C([C@@H]1[C@H]([C@@H]([C@H]([C@@H](O1)O)N)O)O)O`

Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).

No ChEMBL bioactivity data found for this exact protein.

Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).

No ChEMBL hits found through similar proteins.

Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).

Ligand	Tanimoto	MW · LogP · TPSA	Lipinski	PAINS	SMILES
ZINC2060993438 ZINC	0.656	340.3 Da LogP -5.46 TPSA 201.1	2 viol.	✓ Clean	`N[C@@H]1[C@@H](O)O[C@@H](CO)[C@H](O[C@H]2O[C@@H…`
ZINC2060993439 ZINC	0.656	340.3 Da LogP -5.46 TPSA 201.1	2 viol.	✓ Clean	`N[C@@H]1[C@H](O)O[C@H](CO)[C@H](O[C@H]2O[C@H](C…`
ZINC2060993440 ZINC	0.656	340.3 Da LogP -5.46 TPSA 201.1	2 viol.	✓ Clean	`N[C@H]1[C@H](O)[C@@H](O[C@H]2O[C@H](CO)[C@H](O)…`
ZINC2060993441 ZINC	0.656	340.3 Da LogP -5.46 TPSA 201.1	2 viol.	✓ Clean	`N[C@@H]1[C@@H](O[C@H]2[C@@H](CO)O[C@@H](O)[C@@H…`
ZINC2060993442 ZINC	0.656	340.3 Da LogP -5.46 TPSA 201.1	2 viol.	✓ Clean	`N[C@H]1[C@H](O)[C@@H](O[C@H]2O[C@H](CO)[C@H](O)…`
ZINC255997143 ZINC	0.656	340.3 Da LogP -5.46 TPSA 201.1	2 viol.	✓ Clean	`N[C@@H]1[C@H](O[C@@H]2[C@H](CO)O[C@H](O)[C@H](N…`
ZINC255997144 ZINC	0.656	340.3 Da LogP -5.46 TPSA 201.1	2 viol.	✓ Clean	`N[C@@H]1[C@H](O[C@@H]2[C@H](CO)O[C@H](O)[C@H](N…`
ZINC25723126 ZINC	0.656	340.3 Da LogP -5.46 TPSA 201.1	2 viol.	✓ Clean	`N[C@H]1[C@H](O[C@@H]2[C@@H](CO)O[C@@H](O)[C@H](…`
ZINC4535916 ZINC	0.656	340.3 Da LogP -5.46 TPSA 201.1	2 viol.	✓ Clean	`N[C@@H]1[C@H](O[C@@H]2[C@H](CO)O[C@H](O)[C@H](N…`
ZINC4535920 ZINC	0.656	340.3 Da LogP -5.46 TPSA 201.1	2 viol.	✓ Clean	`N[C@@H]1[C@H](O[C@@H]2[C@H](CO)O[C@H](O)[C@H](N…`
ZINC64219075 ZINC	0.656	340.3 Da LogP -5.46 TPSA 201.1	2 viol.	✓ Clean	`N[C@H]1[C@H](O[C@@H]2[C@@H](CO)O[C@@H](O)[C@H](…`
ZINC64219076 ZINC	0.656	340.3 Da LogP -5.46 TPSA 201.1	2 viol.	✓ Clean	`N[C@H]1[C@H](O[C@@H]2[C@H](CO)O[C@@H](O)[C@H](N…`
ZINC64219079 ZINC	0.656	340.3 Da LogP -5.46 TPSA 201.1	2 viol.	✓ Clean	`N[C@H]1[C@H](O[C@@H]2[C@H](CO)O[C@@H](O)[C@H](N…`
ZINC64624873 ZINC	0.656	340.3 Da LogP -5.46 TPSA 201.1	2 viol.	✓ Clean	`N[C@H]1[C@H](O[C@@H]2[C@@H](CO)O[C@H](O)[C@H](N…`
ZINC34007792 ZINC	0.606	341.3 Da LogP -5.43 TPSA 195.3	2 viol.	✓ Clean	`N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O[C@@H]2O[C@H](…`
ZINC34577641 ZINC	0.606	341.3 Da LogP -5.43 TPSA 195.3	2 viol.	✓ Clean	`N[C@H]1[C@@H](O)O[C@H](CO)[C@@H](O[C@@H]2O[C@H]…`
ZINC34328190 ZINC	0.529	259.2 Da LogP -3.43 TPSA 159.5	✓ Ro5	✓ Clean	`N[C@H]1[C@@H](O)O[C@H](CO)[C@@H](O)[C@@H]1OS(=O…`
ZINC43763932 ZINC	0.529	259.2 Da LogP -3.43 TPSA 159.5	✓ Ro5	✓ Clean	`N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1OS(=O)…`
ZINC13543969 ZINC	0.515	259.2 Da LogP -3.43 TPSA 159.5	✓ Ro5	✓ Clean	`N[C@H]1[C@@H](O)O[C@H](COS(=O)(=O)O)[C@@H](O)[C…`
ZINC257487053 ZINC	0.515	259.2 Da LogP -3.43 TPSA 159.5	✓ Ro5	✓ Clean	`N[C@H]1[C@H](O)[C@H](O)[C@@H](COS(=O)(=O)O)O[C@…`
ZINC257487054 ZINC	0.515	259.2 Da LogP -3.43 TPSA 159.5	✓ Ro5	✓ Clean	`N[C@H]1[C@H](O)[C@@H](O)[C@@H](COS(=O)(=O)O)O[C…`
ZINC4097102 ZINC	0.515	259.2 Da LogP -3.14 TPSA 162.7	1 viol.	✓ Clean	`N[C@H]1[C@H](O)O[C@H](COP(=O)(O)O)[C@@H](O)[C@@…`
ZINC4097103 ZINC	0.515	259.2 Da LogP -3.14 TPSA 162.7	1 viol.	✓ Clean	`N[C@H]1[C@@H](O)O[C@H](COP(=O)(O)O)[C@@H](O)[C@…`
ZINC5178949 ZINC	0.515	259.2 Da LogP -3.43 TPSA 159.5	✓ Ro5	✓ Clean	`N[C@H]1[C@H](O)O[C@H](COS(=O)(=O)O)[C@@H](O)[C@…`
ZINC5829843 ZINC	0.515	259.2 Da LogP -3.43 TPSA 159.5	✓ Ro5	✓ Clean	`N[C@@H]1[C@H](O)O[C@H](COS(=O)(=O)O)[C@H](O)[C@…`
ZINC5829963 ZINC	0.515	259.2 Da LogP -3.43 TPSA 159.5	✓ Ro5	✓ Clean	`N[C@@H]1[C@H](O)O[C@H](COS(=O)(=O)O)[C@@H](O)[C…`
ZINC2061000428 ZINC	0.514	251.2 Da LogP -2.76 TPSA 142.5	✓ Ro5	✓ Clean	`C[C@H](O[C@H]1[C@H](N)[C@H](O)O[C@@H](CO)[C@@H]…`
ZINC2061000429 ZINC	0.514	251.2 Da LogP -2.76 TPSA 142.5	✓ Ro5	✓ Clean	`C[C@H](O[C@H]1[C@H](N)[C@@H](O)O[C@@H](CO)[C@@H…`
ZINC254624555 ZINC	0.514	251.2 Da LogP -2.76 TPSA 142.5	✓ Ro5	✓ Clean	`C[C@H](O[C@@H]1[C@H](N)[C@H](O)O[C@@H](CO)[C@@H…`
ZINC254624558 ZINC	0.514	251.2 Da LogP -2.76 TPSA 142.5	✓ Ro5	✓ Clean	`C[C@H](O[C@H]1[C@H](O)[C@H](CO)O[C@@H](O)[C@H]1…`
ZINC254624561 ZINC	0.514	251.2 Da LogP -2.76 TPSA 142.5	✓ Ro5	✓ Clean	`C[C@H](O[C@@H]1[C@H](N)[C@H](O)O[C@H](CO)[C@H]1…`
ZINC3861271 ZINC	0.514	251.2 Da LogP -2.76 TPSA 142.5	✓ Ro5	✓ Clean	`C[C@@H](O[C@H]1[C@H](O)[C@@H](CO)O[C@H](O)[C@@H…`
ZINC4097160 ZINC	0.514	251.2 Da LogP -2.76 TPSA 142.5	✓ Ro5	✓ Clean	`C[C@@H](O[C@H]1[C@H](O)[C@@H](CO)O[C@@H](O)[C@@…`
ZINC4521704 ZINC	0.514	251.2 Da LogP -2.76 TPSA 142.5	✓ Ro5	✓ Clean	`C[C@H](O[C@H]1[C@H](O)[C@@H](CO)O[C@H](O)[C@@H]…`
ZINC5706548 ZINC	0.514	251.2 Da LogP -2.76 TPSA 142.5	✓ Ro5	✓ Clean	`C[C@H](O[C@@H]1[C@H](N)[C@H](O)O[C@H](CO)[C@@H]…`
ZINC5706549 ZINC	0.514	251.2 Da LogP -2.76 TPSA 142.5	✓ Ro5	✓ Clean	`C[C@@H](O[C@@H]1[C@H](N)[C@H](O)O[C@H](CO)[C@@H…`
ZINC5706550 ZINC	0.514	251.2 Da LogP -2.76 TPSA 142.5	✓ Ro5	✓ Clean	`C[C@H](O[C@H]1[C@H](N)[C@H](O)O[C@H](CO)[C@@H]1…`
ZINC5706551 ZINC	0.514	251.2 Da LogP -2.76 TPSA 142.5	✓ Ro5	✓ Clean	`C[C@@H](O[C@H]1[C@H](N)[C@H](O)O[C@H](CO)[C@@H]…`
ZINC104897294 ZINC	0.500	259.2 Da LogP -3.14 TPSA 162.7	1 viol.	✓ Clean	`N[C@@H]1[C@H](OP(=O)(O)O)O[C@H](CO)[C@@H](O)[C@…`
ZINC12503055 ZINC	0.500	259.2 Da LogP -3.14 TPSA 162.7	1 viol.	✓ Clean	`N[C@H]1[C@@H](OP(=O)(O)O)O[C@H](CO)[C@H](O)[C@@…`
ZINC203488208 ZINC	0.500	207.2 Da LogP -2.65 TPSA 93.4	✓ Ro5	✓ Clean	`CN(C)[C@@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O`
ZINC256013684 ZINC	0.500	259.2 Da LogP -3.14 TPSA 162.7	1 viol.	✓ Clean	`N[C@@H]1[C@H](OP(=O)(O)O)O[C@H](CO)[C@H](O)[C@H…`
ZINC257346191 ZINC	0.500	207.2 Da LogP -2.65 TPSA 93.4	✓ Ro5	✓ Clean	`CN(C)[C@H]1[C@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O`
ZINC257346192 ZINC	0.500	207.2 Da LogP -2.65 TPSA 93.4	✓ Ro5	✓ Clean	`CN(C)[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O[C@H]1O`
ZINC257357488 ZINC	0.500	341.3 Da LogP -5.43 TPSA 195.3	2 viol.	✓ Clean	`N[C@H]1[C@@H](O)[C@H](CO)O[C@@H](O[C@H]2O[C@@H]…`
ZINC257357489 ZINC	0.500	341.3 Da LogP -5.43 TPSA 195.3	2 viol.	✓ Clean	`N[C@@H]1[C@H](O)[C@H](CO)O[C@@H](O[C@H]2O[C@@H]…`
ZINC257357490 ZINC	0.500	341.3 Da LogP -5.43 TPSA 195.3	2 viol.	✓ Clean	`N[C@@H]1[C@@H](O)[C@H](CO)O[C@@H](O[C@H]2O[C@@H…`
ZINC3869944 ZINC	0.500	259.2 Da LogP -3.14 TPSA 162.7	1 viol.	✓ Clean	`N[C@@H]1[C@H](OP(=O)(O)O)O[C@H](CO)[C@H](O)[C@@…`
ZINC3869946 ZINC	0.500	259.2 Da LogP -3.14 TPSA 162.7	1 viol.	✓ Clean	`N[C@@H]1[C@H](OP(=O)(O)O)O[C@H](CO)[C@@H](O)[C@…`
ZINC4097029 ZINC	0.500	259.2 Da LogP -3.14 TPSA 162.7	1 viol.	✓ Clean	`N[C@H]1[C@@H](OP(=O)(O)O)O[C@H](CO)[C@@H](O)[C@…`

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

UniProt A0A0H3GL72